PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Psi010211
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family VOZ
Protein Properties Length: 141aa    MW: 16388.6 Da    PI: 9.1503
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Psi#S53187423PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ269.83.5e-83113566200
        VOZ  66 lsakvqgkevgipecegaatakspwnaaelfdlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssf 165
                l ak+ gk vgipecegaatakspwna+elfdl +l+ge +rewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmk++gg krsyymdpqpss+f
  Psi010211   1 LGAKTMGKAVGIPECEGAATAKSPWNAPELFDLFFLQGEVVREWLFFDKPRRAFESGNRKQRSLPDYSGRGWHESRKQVMKDLGGVKRSYYMDPQPSSQF 100
                579************************************************************************************************* PP

        VOZ 166 ewhlyeyeineldalalyrlelklvdekksakgkv 200
                ewhl+eye+n++da+ lyrlelk+vd+kk++kg+ 
  Psi010211 101 EWHLFEYEMNNCDACVLYRLELKQVDSKKNTKGRW 135
                ********************************986 PP

Sequence ? help Back to Top
Protein Sequence    Length: 141 aa     Download sequence    Send to blast
LGAKTMGKAV GIPECEGAAT AKSPWNAPEL FDLFFLQGEV VREWLFFDKP RRAFESGNRK  60
QRSLPDYSGR GWHESRKQVM KDLGGVKRSY YMDPQPSSQF EWHLFEYEMN NCDACVLYRL  120
ELKQVDSKKN TKGRWATTLD R
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Ubiquitous. Expressed in the vascular bundles of various tissues, specifically in the phloem. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator acting positively in the phytochrome B signaling pathway. Functions redundantly with VOZ2 to promote flowering downstream of phytochrome B (phyB). Down-regulates 'FLOWERING LOCUS C' (FLC) and up-regulates 'FLOWERING LOCUS T' (FT). Binds to the 38-bp cis-acting region of the AVP1 gene. Interacts with phyB in the cytoplasm and is translocated to the nucleus at signal transmission, where it is subjected to degradation in a phytochrome-dependent manner. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By far-red light. {ECO:0000269|PubMed:22904146}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011626288.13e-78transcription factor VOZ1
RefseqXP_011626289.13e-78transcription factor VOZ1
RefseqXP_018855072.16e-79PREDICTED: transcription factor VOZ1-like
RefseqXP_018860320.12e-78PREDICTED: transcription factor VOZ1-like isoform X2
SwissprotQ9SGQ02e-74VOZ1_ARATH; Transcription factor VOZ1
TrEMBLA0A199VTN34e-79A0A199VTN3_ANACO; Transcription factor VOZ1
TrEMBLA0A2G5CV061e-77A0A2G5CV06_AQUCA; Uncharacterized protein
STRINGAquca_036_00034.12e-78(Aquilegia coerulea)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.27e-77vascular plant one zinc finger protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Yasui Y,Kohchi T
    VASCULAR PLANT ONE-ZINC FINGER1 and VOZ2 repress the FLOWERING LOCUS C clade members to control flowering time in Arabidopsis.
    Biosci. Biotechnol. Biochem., 2014. 78(11): p. 1850-5
    [PMID:25351333]
  3. Kumar S,Choudhary P,Gupta M,Nath U
    VASCULAR PLANT ONE-ZINC FINGER1 (VOZ1) and VOZ2 Interact with CONSTANS and Promote Photoperiodic Flowering Transition.
    Plant Physiol., 2018. 176(4): p. 2917-2930
    [PMID:29507119]
  4. Song C,Lee J,Kim T,Hong JC,Lim CO
    VOZ1, a transcriptional repressor of DREB2C, mediates heat stress responses in Arabidopsis.
    Planta, 2018. 247(6): p. 1439-1448
    [PMID:29536220]