PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Psi010091
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family NAC
Protein Properties Length: 148aa    MW: 17323.7 Da    PI: 7.34
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-183a-Picea_sitchensis-12683PU_refplantGDBView CDS
gnl|UG|Psi#S38849456PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM175.21.8e-5461361129
        NAM   1 lppGfrFhPtdeelvveyLkkkvegkk.leleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkg 97 
                lppGfrFhPtdeel+ +yLk k+++    ++ evi++vd+y++ePwdLp k  + +++ ewyfFs+rd+ky++g+r+nrat++gyWkatg+d++v+s   
  Psi010091   6 LPPGFRFHPTDEELIFNYLKVKLKNGLkASEVEVIPDVDLYRCEPWDLPeKsFLPNTDMEWYFFSPRDRKYPNGSRTNRATEAGYWKATGRDRKVYS-LA 104
                79********************998764555689**************95334455778**************************************.88 PP

        NAM  98 elvglkktLvfykgrapkgektdWvmheyrle 129
                +++g+kktLvfy+grap+ge+tdWvmheyrle
  Psi010091 105 STIGIKKTLVFYRGRAPQGERTDWVMHEYRLE 136
                89****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.96E-563141IPR003441NAC domain
PROSITE profilePS5100556.2186148IPR003441NAC domain
PfamPF023659.6E-297135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 148 aa     Download sequence    Send to blast
MGTFALPPGF RFHPTDEELI FNYLKVKLKN GLKASEVEVI PDVDLYRCEP WDLPEKSFLP  60
NTDMEWYFFS PRDRKYPNGS RTNRATEAGY WKATGRDRKV YSLASTIGIK KTLVFYRGRA  120
PQGERTDWVM HEYRLEENEC EAGPCLQM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-49613515140Stress-induced transcription factor NAC1
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in a few sieve element cells before enucleation and in phloem-pole pericycle cells. {ECO:0000269|PubMed:25081480}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor directing sieve element enucleation and cytosol degradation. Not required for formation of lytic vacuoles. Regulates, with NAC045, the transcription of NEN1, NEN2, NEN3, NEN4, RTM1, RTM2, UBP16, PLDZETA, ABCB10 and At1g26450. {ECO:0000269|PubMed:25081480}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025879980.14e-74NAC domain-containing protein 86 isoform X2
SwissprotQ9FFI59e-69NAC86_ARATH; NAC domain-containing protein 86
TrEMBLA9NU171e-107A9NU17_PICSI; Uncharacterized protein
STRINGLus100073772e-72(Linum usitatissimum)
STRINGXP_008813657.11e-73(Phoenix dactylifera)
STRINGMLOC_71128.12e-75(Hordeum vulgare)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65910.12e-73NAC domain containing protein 28
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]