PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Psi009865
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family NAC
Protein Properties Length: 159aa    MW: 18425.3 Da    PI: 10.461
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Psi#S38769478PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM168.52.2e-52141401128
        NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelv 100
                +p GfrF+Ptdeel+ +yLkkkv++++l++ ++i+e+d+yk++PwdLp+k+  +ekewyfFs rd+ky++  r+nr++ sgyWkatg+dk+++ +++++v
  Psi009865  14 VPIGFRFDPTDEELLIHYLKKKVSSSPLPA-SIIAEIDLYKHDPWDLPAKAFFGEKEWYFFSLRDRKYPNRARPNRSAGSGYWKATGTDKPIVISSSQKV 112
                589***************************.89***************8777899********************************************* PP

        NAM 101 glkktLvfykgrapkgektdWvmheyrl 128
                g+kk+Lvfykgr  kg kt+W+mheyrl
  Psi009865 113 GVKKSLVFYKGRPLKGIKTNWIMHEYRL 140
                **************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.35E-579145IPR003441NAC domain
PROSITE profilePS5100552.58114159IPR003441NAC domain
PfamPF023658.6E-2715140IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 159 aa     Download sequence    Send to blast
MEGLEFHQQV LPQVPIGFRF DPTDEELLIH YLKKKVSSSP LPASIIAEID LYKHDPWDLP  60
AKAFFGEKEW YFFSLRDRKY PNRARPNRSA GSGYWKATGT DKPIVISSSQ KVGVKKSLVF  120
YKGRPLKGIK TNWIMHEYRL AETLPTKRKG SIRVRIPYS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A2e-611415420157NAC domain-containing protein 19
3swm_B2e-611415420157NAC domain-containing protein 19
3swm_C2e-611415420157NAC domain-containing protein 19
3swm_D2e-611415420157NAC domain-containing protein 19
3swp_A2e-611415420157NAC domain-containing protein 19
3swp_B2e-611415420157NAC domain-containing protein 19
3swp_C2e-611415420157NAC domain-containing protein 19
3swp_D2e-611415420157NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Psi.123140.0needle
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Up-regulated during anther and flower development and leaf senescence. {ECO:0000269|PubMed:22278768}.
UniprotTISSUE SPECIFICITY: Highest expression in stamens. Expressed in leaves. {ECO:0000269|PubMed:18813954, ECO:0000269|PubMed:22278768}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor of the NAC family associated with male fertility. Involved in anther development, but not in senescence. Reduced expression of NAC5 via RNAi leads to male-sterility. {ECO:0000269|PubMed:22278768}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated by drought, salt and cold treatments. {ECO:0000269|PubMed:18813954}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019453752.15e-73PREDICTED: NAC transcription factor 56-like
RefseqXP_021992824.13e-73NAC transcription factor 25-like
RefseqXP_024967722.14e-73NAC transcription factor 56-like
SwissprotQ8H4S47e-70NAC10_ORYSJ; NAC domain-containing protein 10
TrEMBLD5ABS02e-94D5ABS0_PICSI; Uncharacterized protein
STRINGXP_007149615.17e-71(Phaseolus vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61110.14e-72NAC domain containing protein 25
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]