PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Psi008980
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family NAC
Protein Properties Length: 198aa    MW: 22311.4 Da    PI: 7.7387
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Psi#S42999338PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM38.34.1e-1284096128
        NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                  + +glkk+Lvfykg+ap g+ktdW+m+eyrl
  Psi008980   8 LLQCIGLKKILVFYKGKAPYGQKTDWIMNEYRL 40 
                45679**************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100520.389161IPR003441NAC domain
SuperFamilySSF1019414.71E-141161IPR003441NAC domain
PfamPF023651.3E-41240IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 198 aa     Download sequence    Send to blast
XRAIRNELLQ CIGLKKILVF YKGKAPYGQK TDWIMNEYRL PDLRSSSVKV RDIVLCRIYR  60
KAASQKSMEL QAKPDHVVKE EMAVSGDEYE DTSYSTTLND GGQLSNPMTE IEVSSLYYQK  120
RERVCSSDQS KTNNGDSLYE CLEPIMLSEE TRVLKNPKAC KTALLELPNM SLNCPLSQPI  180
ATPPALLSTP PPFQPSLI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A4e-151064112168NO APICAL MERISTEM PROTEIN
1ut4_B4e-151064112168NO APICAL MERISTEM PROTEIN
1ut7_A4e-151064112168NO APICAL MERISTEM PROTEIN
1ut7_B4e-151064112168NO APICAL MERISTEM PROTEIN
3swm_A5e-151064115171NAC domain-containing protein 19
3swm_B5e-151064115171NAC domain-containing protein 19
3swm_C5e-151064115171NAC domain-containing protein 19
3swm_D5e-151064115171NAC domain-containing protein 19
3swp_A5e-151064115171NAC domain-containing protein 19
3swp_B5e-151064115171NAC domain-containing protein 19
3swp_C5e-151064115171NAC domain-containing protein 19
3swp_D5e-151064115171NAC domain-containing protein 19
4dul_A4e-151064112168NAC domain-containing protein 19
4dul_B4e-151064112168NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Psi.193710.0needle
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A075M5N52e-75A0A075M5N5_9SPER; NAC domain protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G17040.13e-19NAC domain containing protein 36