PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Psi006246
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family NAC
Protein Properties Length: 812aa    MW: 90029.2 Da    PI: 5.1897
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Psi#S50073214PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM171.62.4e-5361361129
        NAM   1 lppGfrFhPtdeelvveyLkkkvegkk.leleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkg 97 
                lppGfrFhPtdeel+++yLk k+++     + evi+evd+yk+ePwdLp k  + +++ ewyfFs+rd+ky++g+r+nrat++gyWkatg+d++++s + 
  Psi006246   6 LPPGFRFHPTDEELISCYLKGKLNHGLkAAELEVISEVDLYKLEPWDLPeKsFLPSTDMEWYFFSPRDRKYPNGSRTNRATEAGYWKATGRDRKIYS-RA 104
                79********************987763555689**************95344556788**************************************.88 PP

        NAM  98 elvglkktLvfykgrapkgektdWvmheyrle 129
                +++g+kktLvfy+grap+ge+tdWvmheyrle
  Psi006246 105 STIGIKKTLVFYRGRAPQGERTDWVMHEYRLE 136
                99****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.84E-613158IPR003441NAC domain
PROSITE profilePS5100561.0436158IPR003441NAC domain
PfamPF023651.3E-277135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 812 aa     Download sequence    Send to blast
MGTFALPPGF RFHPTDEELI SCYLKGKLNH GLKAAELEVI SEVDLYKLEP WDLPEKSFLP  60
STDMEWYFFS PRDRKYPNGS RTNRATEAGY WKATGRDRKI YSRASTIGIK KTLVFYRGRA  120
PQGERTDWVM HEYRLEENES EAGPCLQNAF VLCRVFKKSG LGEKSGEQYT TQVEKGDLSL  180
IKKNLSPGYF GDIEVHSEEQ SKPVEGIDAN SHLPSKISSK ILNDTTGDSA PLNKWLDILL  240
DDTNSNSSCV ALDEDTIHTQ VDAMPDTPRM QCDSACLPFD ESEFPQIPVN ISFSQYGVPN  300
VCLDAYFEEE RMLDEMLSAA SQDYTNSKAY HSFLGDTLAD ILNGGYIKVK HLLPSMEELE  360
NHDSCLWEVP NPSLHHDGTG IQICSRSPVL QSHKRGILSE GTAARRVRMQ LHKMEDSVER  420
NEKDVNVRHS QNMSNDWYDS KSDSTSCPEM QQLHFGQFDG QKCNSENIRE NEDSVPEALA  480
TYMAGRIDGL SFQKHDQIVD AANSAFVYNS VEDVKSIAVS HNITSMPPYS SSYGLFIKKE  540
SSEIIELPTN IFQTTVKDKT NCVNDFQSLS LDLTPSSSPG NSSPAMSMRN KISNPKTNDQ  600
TSSERYLLDS NKPSITEHVQ KSENSASKNA IGILTQAACL GKDSPPEKVL HNSGTSLEHG  660
PQMKELELNS SETMVVGLHN EDPKPSKILS KFLSCIPASP GSAMECNANL NPAKVILDSN  720
VGTNSGLVCV ATTNGHVSAT SLISTCSIEG VGFPASDTVS SRXKIQKEAR TQKHSVDEEK  780
RGVVMDESYG RCAKQHINGT GLSFEQPRQF FS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A1e-52416418174NAC domain-containing protein 19
3swm_B1e-52416418174NAC domain-containing protein 19
3swm_C1e-52416418174NAC domain-containing protein 19
3swm_D1e-52416418174NAC domain-containing protein 19
3swp_A1e-52416418174NAC domain-containing protein 19
3swp_B1e-52416418174NAC domain-containing protein 19
3swp_C1e-52416418174NAC domain-containing protein 19
3swp_D1e-52416418174NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Psi.77010.0shoot
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLB8LLW80.0B8LLW8_PICSI; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65910.12e-76NAC domain containing protein 28