PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Psi001932
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family NAC
Protein Properties Length: 392aa    MW: 45276.9 Da    PI: 7.0903
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-183a-Picea_sitchensis-14131PU_refplantGDBView CDS
gnl|UG|Psi#S50073182PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1683.2e-52111391128
        NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeek...ewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkg 97 
                +ppGfrFhPt+eel+ +yLkkkv+ +k++l +vi++vd++k+ePwd+++++k +++   +wyfFs++dkky+tg+r+nrat++g+Wkatg+dk++++ + 
  Psi001932  11 VPPGFRFHPTEEELLYYYLKKKVSFEKIDL-DVIRDVDLNKLEPWDIQERCKIGSTpqhDWYFFSHKDKKYPTGTRTNRATAAGFWKATGRDKAIHT-NL 108
                69****************************.9***************9644443333359************************************9.99 PP

        NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
                +++g++ktLvfykgrap+g+ktdW+mheyrl
  Psi001932 109 KKIGMRKTLVFYKGRAPHGQKTDWIMHEYRL 139
                9****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.7E-567166IPR003441NAC domain
PROSITE profilePS5100556.45211166IPR003441NAC domain
PfamPF023651.6E-2712139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 392 aa     Download sequence    Send to blast
MSLSVNGQSR VPPGFRFHPT EEELLYYYLK KKVSFEKIDL DVIRDVDLNK LEPWDIQERC  60
KIGSTPQHDW YFFSHKDKKY PTGTRTNRAT AAGFWKATGR DKAIHTNLKK IGMRKTLVFY  120
KGRAPHGQKT DWIMHEYRLD DAEYPQANTF NELQEDGWVV CRVFKKRNHH KSQESAELSP  180
KYGSKQFSNN KILSDSDCPS DNLTDPLHYT HQLNMCKQEL EMQQYAFPHD QFMQLPQLES  240
PKIPTCNNPP SSGIKRFFPD SRSGFFQLEN ITSSKRPCSY PMNLDMTELE GSTVTTHDHM  300
TDFKPAEEVQ NLQDWTVLDR LVASHLNGQE IETPKLGIRS YGAPNSSSDH QALVDAATVS  360
GDQLTLLPQL RINRLNPHDY ASCEIDLWNF VK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A7e-491116815170Stress-induced transcription factor NAC1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Psi.44370.0shoot
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in various aboveground tissues undergoing thickening of the lignified secondary wall such as anthers, filaments of stamens, the base of carpels, styles, the boundaries between siliques and pedicels, the midrib of leaf veins, and inflorescence stems, specifically in interfascicular fibers (sclerenchyma), cells differentiating into vascular vessels, and xylary fibers (secondary xylem). {ECO:0000269|PubMed:16214898, ECO:0000269|PubMed:17237351}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator of genes involved in biosynthesis of secondary walls. Together with NST2 and NST3, required for the secondary cell wall thickening of sclerenchymatous fibers, secondary xylem (tracheary elements), and of the anther endocethium, which is necessary for anther dehiscence. May also regulate the secondary cell wall lignification of other tissues. {ECO:0000269|PubMed:16214898, ECO:0000269|PubMed:17237351, ECO:0000269|PubMed:17333250}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024993238.11e-117NAC domain-containing protein 43-like
SwissprotQ84WP61e-104NAC43_ARATH; NAC domain-containing protein 43
TrEMBLB8LLZ90.0B8LLZ9_PICSI; Uncharacterized protein
STRINGXP_009360199.11e-116(Pyrus x bretschneideri)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46770.14e-86NAC family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Gondolf VM, et al.
    A gene stacking approach leads to engineered plants with highly increased galactan levels in Arabidopsis.
    BMC Plant Biol., 2014. 14: p. 344
    [PMID:25492673]
  3. Jaradat MR,Ruegger M,Bowling A,Butler H,Cutler AJ
    A comprehensive transcriptome analysis of silique development and dehiscence in Arabidopsis and Brassica integrating genotypic, interspecies and developmental comparisons.
    GM Crops Food, 2014. 5(4): p. 302-20
    [PMID:25523176]
  4. Yuan Y,Teng Q,Zhong R,Ye ZH
    TBL3 and TBL31, Two Arabidopsis DUF231 Domain Proteins, are Required for 3-O-Monoacetylation of Xylan.
    Plant Cell Physiol., 2016. 57(1): p. 35-45
    [PMID:26556650]
  5. Yang C, et al.
    Transcription Factor MYB26 Is Key to Spatial Specificity in Anther Secondary Thickening Formation.
    Plant Physiol., 2017. 175(1): p. 333-350
    [PMID:28724622]
  6. Pascual MB, et al.
    PpNAC1, a main regulator of phenylalanine biosynthesis and utilization in maritime pine.
    Plant Biotechnol. J., 2018. 16(5): p. 1094-1104
    [PMID:29055073]
  7. Liu C,Yu H,Li L
    SUMO modification of LBD30 by SIZ1 regulates secondary cell wall formation in Arabidopsis thaliana.
    PLoS Genet., 2019. 15(1): p. e1007928
    [PMID:30657769]