PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Psi000476
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family NAC
Protein Properties Length: 270aa    MW: 30327.4 Da    PI: 6.3695
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-183a-Picea_sitchensis-12032PU_refplantGDBView CDS
gnl|UG|Psi#S55420915PU_unrefUnigeneView CDS
gnl|UG|Psi#S38770186PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM159.99.8e-50141401128
        NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelv 100
                lp+GfrF+Ptdeel+ +yLkkkv++++++  +vi+e+d+yk++PwdLp+k+  +ekewyfFs+rd++y++g  +nr++ sgyWkatg+dk+++ +++++v
  Psi000476  14 LPVGFRFEPTDEELLIYYLKKKVSSSPFPG-SVIAEIDLYKHDPWDLPAKAFFGEKEWYFFSPRDREYPNGAPPNRSAGSGYWKATGTDKPIVITSSQKV 112
                79***************************9.99***************8777899********************************************* PP

        NAM 101 glkktLvfykgrapkgektdWvmheyrl 128
                g+kk+Lvfykg   +g kt+W+mheyrl
  Psi000476 113 GVKKSLVFYKGMPLQGLKTNWIMHEYRL 140
                **************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.96E-599164IPR003441NAC domain
PROSITE profilePS5100557.02814165IPR003441NAC domain
PfamPF023658.0E-2715140IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 270 aa     Download sequence    Send to blast
MEGLAFHQQV LLQLPVGFRF EPTDEELLIY YLKKKVSSSP FPGSVIAEID LYKHDPWDLP  60
AKAFFGEKEW YFFSPRDREY PNGAPPNRSA GSGYWKATGT DKPIVITSSQ KVGVKKSLVF  120
YKGMPLQGLK TNWIMHEYRL AETLPSERKG SMLLDDWVLC RIYEKVSYSP MVVSCQDVEA  180
LSPDLRRTRQ KSAMLKFSSF SRLLLRDGPF MESLLSHATS DANNAAVSST ESLSSLQEDL  240
PQRNSSEGGS HVSMSLGFNG DEVSSEYPAT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A4e-721216715167NO APICAL MERISTEM PROTEIN
1ut4_B4e-721216715167NO APICAL MERISTEM PROTEIN
1ut7_A4e-721216715167NO APICAL MERISTEM PROTEIN
1ut7_B4e-721216715167NO APICAL MERISTEM PROTEIN
4dul_A4e-721216715167NAC domain-containing protein 19
4dul_B4e-721216715167NAC domain-containing protein 19
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1185191RRTRQKS
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Psi.50040.0needle
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed during pollen development and maturation. {ECO:0000269|PubMed:21107887}.
UniprotTISSUE SPECIFICITY: Expressed specifically in the tapetum. {ECO:0000269|PubMed:21107887}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor of the NAC family. May be associated with anther development and pollen production (Probable). Required for normal seed development and morphology (PubMed:18849494). {ECO:0000269|PubMed:18849494, ECO:0000305|PubMed:21107887}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011095244.12e-81NAC transcription factor 56-like
SwissprotQ8GY423e-75NAC25_ARATH; NAC transcription factor 25
TrEMBLD5ABS00.0D5ABS0_PICSI; Uncharacterized protein
STRINGERN033808e-79(Amborella trichopoda)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04070.25e-78NAC domain containing protein 47