PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Psi000201
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family NAC
Protein Properties Length: 660aa    MW: 73627.8 Da    PI: 4.5484
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-183a-Picea_sitchensis-31318PU_refplantGDBView CDS
gnl|UG|Psi#S50071713PU_unrefUnigeneView CDS
PUT-183a-Picea_sitchensis-10518PU_unrefplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM172.81e-5361341129
        NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98 
                l+pGfrFhPtdeelv++yLk+kv+g+++++ ++i+e+d+yk+eP+dLp k ++++++ ewyfF ++d+ky++g+r+nr+tk+gyWk+tgkd++v+s  ++
  Psi000201   6 LQPGFRFHPTDEELVSYYLKRKVRGQRFDF-NAISEIDLYKFEPRDLPgKsCLQSRDLEWYFFNPKDRKYPNGSRTNRSTKDGYWKTTGKDRPVCS-ASQ 103
                579**************************9.89***************6347778888**************************************.999 PP

        NAM  99 lvglkktLvfykgrapkgektdWvmheyrle 129
                +vg+kktLv+++grap+ge+t+Wvmheyrle
  Psi000201 104 TVGMKKTLVYHTGRAPRGERTNWVMHEYRLE 134
                *****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019419.42E-622156IPR003441NAC domain
PROSITE profilePS5100558.8646156IPR003441NAC domain
PfamPF023657.1E-298133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 660 aa     Download sequence    Send to blast
MDQVSLQPGF RFHPTDEELV SYYLKRKVRG QRFDFNAISE IDLYKFEPRD LPGKSCLQSR  60
DLEWYFFNPK DRKYPNGSRT NRSTKDGYWK TTGKDRPVCS ASQTVGMKKT LVYHTGRAPR  120
GERTNWVMHE YRLEGKDLKM SNPAQDSYVL CRVFQKSGPG PKNGEQYGAP FREEDWNADI  180
FSKAEEISSV EMDHVATNDS TLSKTEEIIA HCGGVPALDN VIVSPVEELA PSTYDYDIDS  240
ILNTWIDNPD DIEPNAKENE LVQGNQEWDA LISKETLEQT VMQTEDGEVF NDLGDLFGNI  300
NNPVQRNTED YVDIFHVQDS MRVGEKGSTS IDPFLSNLHE SSPAFLDGSF LELKDLVNPV  360
ELNTSDLETF DRKDTFFDVS DCPDNFAAPS MALHPKESQN QHTDLSFLRG KQEMSTGVSE  420
QTQIPYGYSV LQEAYNVERH LYSSPVGENS GASYWMQEQW MNNGFAFSEI DDARNLAPSA  480
DDEFMMTRQD VSAGMQSSKN HEDYDTGSSS KFASLLASIH ARPASAAEYP FRSKYLSQLP  540
KVDSVTVETA INHVAAVSVT CACSMVLEPK IEHSSGDLLS TCSCGVANGI VQGSFVSSWP  600
ASSSIGFKSA DSVTPRKTSS GLHAGFLFVF FLGAISVFVW ALVVGGTFIL GKYIYKLVIS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A8e-55315612168Stress-induced transcription factor NAC1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Psi.150500.0shoot
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLB8LQV40.0B8LQV4_PICSI; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04410.13e-84NAC domain containing protein 2