PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Psi000148
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family YABBY
Protein Properties Length: 189aa    MW: 20704.5 Da    PI: 8.4947
Description YABBY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-183a-Picea_sitchensis-16738PU_refplantGDBView CDS
PUT-183a-Picea_sitchensis-15828PU_unrefplantGDBView CDS
PUT-183a-Picea_sitchensis-7567PU_unrefplantGDBView CDS
gnl|UG|Psi#S55420090PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1YABBY192.81.6e-5981555170
      YABBY   5 ssseqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtsllsvnlakasqllaaeshldeslkeelleelkveeenl.ksnvekeesastsvsseklse 103
                s++eq+Cyv+CnfC+tilavsvPs+slf++vtvrCGhC +llsvn++ as  l a +         ++++  +++ +   s +++e++a         ++
  Psi000148   8 SAAEQLCYVHCNFCSTILAVSVPSSSLFNIVTVRCGHCNHLLSVNMMGASPPLEAGQ---------IQNDYSKDSASSsASPTISERTA---------NS 89 
                679******************************************999887776665.........23332222222101222222222.........22 PP

      YABBY 104 nedeevprvppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahfPkihfgl 170
                   +e+ ++     PPekrqrvPs ynrfikeeiqrika+nPdi h+eafsaaaknWahfP+ihfgl
  Psi000148  90 YAGNEAVKMFS-SIPPEKRQRVPSVYNRFIKEEIQRIKAKNPDIRHKEAFSAAAKNWAHFPHIHFGL 155
                23344455555.67***************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046902.8E-659155IPR006780YABBY protein
SuperFamilySSF470953.27E-799149IPR009071High mobility group box domain
Gene3DG3DSA:1.10.30.105.6E-4104147IPR009071High mobility group box domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007275Biological Processmulticellular organism development
Sequence ? help Back to Top
Protein Sequence    Length: 189 aa     Download sequence    Send to blast
MSGCIESSAA EQLCYVHCNF CSTILAVSVP SSSLFNIVTV RCGHCNHLLS VNMMGASPPL  60
EAGQIQNDYS KDSASSSASP TISERTANSY AGNEAVKMFS SIPPEKRQRV PSVYNRFIKE  120
EIQRIKAKNP DIRHKEAFSA AAKNWAHFPH IHFGLMLENN KQAAIDKGNL REGTQIGTVK  180
DGRMTTNLC
Functional Description ? help Back to Top
Source Description
UniProtPromotes adaxial cell identity. Regulates the initiation of embryonic shoot apical meristem (SAM) development. {ECO:0000269|PubMed:19837869}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006424060.21e-66putative axial regulator YABBY 2 isoform X1
SwissprotQ8GW462e-61YAB5_ARATH; Axial regulator YABBY 5
TrEMBLD5A7T21e-124D5A7T2_PICSI; Uncharacterized protein
TrEMBLD5ADY51e-125D5ADY5_PICSI; Uncharacterized protein
STRINGXP_006487832.11e-65(Citrus sinensis)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G26580.23e-62YABBY family protein
Publications ? help Back to Top
  1. Husbands AY,Benkovics AH,Nogueira FT,Lodha M,Timmermans MC
    The ASYMMETRIC LEAVES Complex Employs Multiple Modes of Regulation to Affect Adaxial-Abaxial Patterning and Leaf Complexity.
    Plant Cell, 2015. 27(12): p. 3321-35
    [PMID:26589551]