PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID model.Picochlorum_contig_19.g55.t1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Trebouxiophyceae; Trebouxiophyceae incertae sedis; Picochlorum
Family M-type_MADS
Protein Properties Length: 309aa    MW: 33867.8 Da    PI: 9.1023
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
model.Picochlorum_contig_19.g55.t1genomeRutgersView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF35.51.2e-112267651
                                        HHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                              SRF-TF  6 ksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                                        +sn    f  R+n +   A ELS  +d e+++i++s++g+l  +s+
  model.Picochlorum_contig_19.g55.t1 22 SSNYDSVFVHRKNALYRRAAELSAITDCEISIIVLSPDGELSQFST 67
                                        56667779************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006612.6712269IPR002100Transcription factor, MADS-box
SuperFamilySSF554556.28E-132694IPR002100Transcription factor, MADS-box
PfamPF003196.6E-82865IPR002100Transcription factor, MADS-box
PRINTSPR004042.8E-53146IPR002100Transcription factor, MADS-box
PRINTSPR004042.8E-54667IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 309 aa     Download sequence    Send to blast
MRTSTRRAAG NRRPRDVQSS LSSNYDSVFV HRKNALYRRA AELSAITDCE ISIIVLSPDG  60
ELSQFSTAPM KKILRAYSRL CSSPHEIHNM ESIQKKLVSA GGEGVGLLMP QEDEGVQKKQ  120
KQKQKKKVAQ KKNVKKVEDD LEDAGEMIEA ILAMRGSTVK EEPGRDENLG DGDEDKGTGT  180
DTDETLEEGN GMDRSGTVSN SSEKRQGESG DGEPTHGKRR LTEVQDSVQK KHRLSKVDFS  240
RDQQSVQTAD EKKKAQGRCD DKSPTRLGAD ARGHIGVGTP LNRKQKPLPP SVDPIPLLGP  300
DVRPRTDS*
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP36561314
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45660.12e-08AGAMOUS-like 20