PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID model.Picochlorum_contig_101.g736.t1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Trebouxiophyceae; Trebouxiophyceae incertae sedis; Picochlorum
Family G2-like
Protein Properties Length: 366aa    MW: 40165.2 Da    PI: 5.3815
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
model.Picochlorum_contig_101.g736.t1genomeRutgersView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like84.41.2e-26104157155
                               G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                                           k rl+W++eLH+rF++a+++L G +kA+Pk+il lm+v+g+t+e+v+SHLQkYRl
  model.Picochlorum_contig_101.g736.t1 104 KMRLVWSQELHNRFLNALSHL-GLKKAVPKNILGLMNVEGMTRENVASHLQKYRL 157
                                           67*******************.********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.024101160IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.4E-26102161IPR009057Homeodomain-like
SuperFamilySSF466899.85E-18103161IPR009057Homeodomain-like
TIGRFAMsTIGR015575.5E-24104157IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 366 aa     Download sequence    Send to blast
MPSEPRDSKR KAADDAEVST EGKVHKADDG QVRAGVVGEQ PAGPSGWGIG DVARAHAQQR  60
GGVKSEDEAP VIGLPLKKNP APVERDVPNP TKSDRSDDSS SDRKMRLVWS QELHNRFLNA  120
LSHLGLKKAV PKNILGLMNV EGMTRENVAS HLQKYRLYLK KNGGYTAKDK ISSDRLQELH  180
EENVQRMASQ EAMQQNVSFM DPQGMGGFGN FPPHFQAEIP HMPSEEIEYK PQLIVDGIPI  240
GDPPPQPVVT SAMFTNPIPK PDMSPAVQEV DGGHFNPNKW KYPAFPGDTE QQEQSGIGKG  300
EEEEYHHHHH HHGHLPYNAA HEEKSDDIFE DKSVDHAAQP SSGTGSDDDD GDELLVNNNN  360
SLHDA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A2e-20100161162ARR10-B
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP1111645
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G46640.33e-25G2-like family protein