PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.I004500.1.p
Common NamePRUPE_ppa002472mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family GRAS
Protein Properties Length: 679aa    MW: 76744.6 Da    PI: 6.5952
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.I004500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS392.93.5e-1203056762374
               GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkf 93 
                         +lL++cA+av+s d++ a++lL+++++++sp+gd++qRla+yf+ +L+arla+  +  y+ l + + s    +e l+a+++f+  sP+ ++
  Prupe.I004500.1.p 305 STLLTQCAQAVASYDQRTASELLKQIRQHSSPYGDANQRLAHYFADGLEARLAGARTPSYSFLVSMQIS---AAEILKAYEVFVTSSPFKTV 393
                        579***************************************************999999999999998...9******************* PP

               GRAS  94 shltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlva 183
                        sh++aN++Il+ +e+++r+H+iDf+is+G+QWp+++q L++Rp+gpp+lRiT+++ p++g   +e++eetg+rL+k+Ae+++vpfe+nv +a
  Prupe.I004500.1.p 394 SHFLANKTILKLAEKATRLHVIDFGISYGFQWPCFIQHLSKRPGGPPKLRITAIELPQPGfrPTERVEETGRRLKKYAERFNVPFEYNV-IA 484
                        ***********************************************************9****************************9.7* PP

               GRAS 184 krledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleakl 275
                        +++e++++e+L+++++E+++Vn++ +l++++de+v ++s+rd vLkl+k+++P+++++   +  +ns+ F++rf eal ++salfd +ea++
  Prupe.I004500.1.p 485 QKWETIQFEDLKIDRNEVIVVNCMNRLKHIPDETVMVNSPRDIVLKLIKKINPNLFIHGVVNGTYNSPFFVTRFREALFHFSALFDVFEASV 576
                        ******************************************************************************************** PP

               GRAS 276 preseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrp 366
                        pre+e r + E+ + gr+i nvvaceg er+er et+++W+ r  +aGFk++p++++  k++k++l+ ++  + +r++e+ +++++gWk+r+
  Prupe.I004500.1.p 577 PREDERRLMFEKYVYGRDILNVVACEGLERVERPETYKQWQVRNVRAGFKQLPVDQELLKKMKRILKFMGyHNDFRIDEDGHWILQGWKGRT 668
                        *******************************************************************9999999****************** PP

               GRAS 367 LvsvSaWr 374
                        ++++S+W+
  Prupe.I004500.1.p 669 ILALSFWK 676
                        *******8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098567.247278655IPR005202Transcription factor GRAS
PfamPF035141.2E-117305676IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 679 aa     Download sequence    Send to blast
MGSIQVNQES TSPVCLSTNL DHLSDSNTSL SSGSDGDAID ISEYNHPVIK YISDILEEDL  60
EGKPCMLQDC LALQAAEKSF YDVLNQNDHP SPKQPPLSVH QSFENSDDDS PHSCHSSNGS  120
IAVKTNWVFD RSEASHVQSS LVQSLSDAGL VSDSLSEMQS LGHFGGLGEA SKFLPNVKLE  180
GYRLMLPGLD QWPSSTNILM TTPDNDGYKS TNGSKGKKNN QREDADYPEE GRSNKQPVAF  240
ADDSEPQEMF DEVLLCHGNH EFESCSPDES LITVGSGKLQ RNKQKGSKTA RSKKQNNNWE  300
LVDLSTLLTQ CAQAVASYDQ RTASELLKQI RQHSSPYGDA NQRLAHYFAD GLEARLAGAR  360
TPSYSFLVSM QISAAEILKA YEVFVTSSPF KTVSHFLANK TILKLAEKAT RLHVIDFGIS  420
YGFQWPCFIQ HLSKRPGGPP KLRITAIELP QPGFRPTERV EETGRRLKKY AERFNVPFEY  480
NVIAQKWETI QFEDLKIDRN EVIVVNCMNR LKHIPDETVM VNSPRDIVLK LIKKINPNLF  540
IHGVVNGTYN SPFFVTRFRE ALFHFSALFD VFEASVPRED ERRLMFEKYV YGRDILNVVA  600
CEGLERVERP ETYKQWQVRN VRAGFKQLPV DQELLKKMKR ILKFMGYHND FRIDEDGHWI  660
LQGWKGRTIL ALSFWKKA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-463086768375GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppe.199850.0fruit
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007211326.10.0hypothetical protein PRUPE_ppa002472mg
SwissprotQ9XE580.0SCL14_ARATH; Scarecrow-like protein 14
TrEMBLM5X0F40.0M5X0F4_PRUPE; Uncharacterized protein
STRINGPOPTR_0009s03850.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13134339
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.10.0SCARECROW-like 14