PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.I004400.1.p
Common NamePRUPE_ppa002166mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family GRAS
Protein Properties Length: 707aa    MW: 79888.5 Da    PI: 5.8234
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.I004400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS381.97.4e-1173337042374
               GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkf 93 
                         +lL++cA+av+s d++ a++lL+++++++sp+gd++qR a+yf+ +L+arla+  +  y+ l + + s    +e l+a+++++  sP+ k+
  Prupe.I004400.1.p 333 STLLTQCAQAVASYDQRTASELLKQIRQHSSPYGDATQRSAHYFADGLEARLAGARTPSYSPLVSMQIS---AAEILKAHEVYVTSSPFKKL 421
                        579***************************************************999999999999998...9******************* PP

               GRAS  94 shltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlva 183
                        s+++aN++Il+ +e+++r+H+iDf+is+G+QWp++++ L++Rp+gpp+lRiT+++ p++g   +e++eetg+rL+k+Ae+++vpfe+nv +a
  Prupe.I004400.1.p 422 SNFLANRTILKLAEKATRLHVIDFGISYGFQWPCFIHRLSERPGGPPKLRITAIELPQPGfrPTERVEETGRRLEKYAERFNVPFEYNV-IA 512
                        ***********************************************************9****************************9.7* PP

               GRAS 184 krledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleakl 275
                        +++e++++e+L+++++E+++Vn++ +l++++de+v ++s+rd vLkl+k+++P+++++   +  +ns+ F++rf eal ++salfd++ea++
  Prupe.I004400.1.p 513 QKWETIQFEDLKIDRNEVIVVNCMNRLKHMPDETVMVNSPRDIVLKLIKKINPDLFIHGVVNGTYNSPFFVTRFKEALFHFSALFDMFEASV 604
                        ******************************************************************************************** PP

               GRAS 276 preseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrp 366
                        pre+e r   E+++ gr+i nvvaceg er+er et+++W+ r  +aGFk++pl+++  k +k++l+ ++  + ++++e+ +++++gWk+r 
  Prupe.I004400.1.p 605 PREDERRLLFEKAVYGRDILNVVACEGLERVERPETYKQWQVRNVRAGFKQLPLDQELLKRVKRMLKFMGyHNDFSIDEDGHWMLQGWKGRI 696
                        *******************************************************************9999999****************** PP

               GRAS 367 LvsvSaWr 374
                          ++S+W+
  Prupe.I004400.1.p 697 TRALSFWK 704
                        *******8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098566.535306683IPR005202Transcription factor GRAS
PfamPF035142.6E-114333704IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 707 aa     Download sequence    Send to blast
MDTLLERYYL SMERFNFGHG SASLYSNQNL VNGFQVNQES TSPVHLSTNL DHPSDSSTSL  60
SSGSDGDTVD FSDYNHPVLK YVSDILLEED LEGKTCMLQD CLALQAAEKS FYDVLNQEDP  120
PSPNQLPLSV HQSFENSDDD SPRSCHRSNG SIAPNTDWVF DPSETSNVQS SLVQSLSDAG  180
LVSDSLSEIG HSGGLGEASK FLPNVKLEGN RLMPPGLDQW PSSTNILMTT PDNDGYNSTN  240
GSKGKKNHQR EDADYPEEGR SNKQPVAFAD DSEPQEMFDE VLLCHGNHEF ESCSPDESLI  300
AEGSGKLQRN KQKGSKTARS KKQNNNWELV DLSTLLTQCA QAVASYDQRT ASELLKQIRQ  360
HSSPYGDATQ RSAHYFADGL EARLAGARTP SYSPLVSMQI SAAEILKAHE VYVTSSPFKK  420
LSNFLANRTI LKLAEKATRL HVIDFGISYG FQWPCFIHRL SERPGGPPKL RITAIELPQP  480
GFRPTERVEE TGRRLEKYAE RFNVPFEYNV IAQKWETIQF EDLKIDRNEV IVVNCMNRLK  540
HMPDETVMVN SPRDIVLKLI KKINPDLFIH GVVNGTYNSP FFVTRFKEAL FHFSALFDMF  600
EASVPREDER RLLFEKAVYG RDILNVVACE GLERVERPET YKQWQVRNVR AGFKQLPLDQ  660
ELLKRVKRML KFMGYHNDFS IDEDGHWMLQ GWKGRITRAL SFWKKA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A5e-413367048375GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppe.199850.0fruit
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007211325.10.0hypothetical protein PRUPE_ppa002166mg
SwissprotQ9XE580.0SCL14_ARATH; Scarecrow-like protein 14
TrEMBLM5WFN10.0M5WFN1_PRUPE; Uncharacterized protein
STRINGPOPTR_0009s03850.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13134339
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.10.0SCARECROW-like 14