PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.8G266100.1.p
Common NamePRUPE_ppa023374mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family GRAS
Protein Properties Length: 641aa    MW: 72100.3 Da    PI: 5.5782
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.8G266100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS285.71.3e-872756382374
                GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilk 92 
                          + Ll++Ae v  +++e+a++lL r + +as +g+p+qR+++yf+eAL++r+ r++ ++ ++ +  + s +  s++   + + ++  P++ 
  Prupe.8G266100.1.p 275 AHILLAAAEKVGYQQFERANRLLLRCEWIASFKGNPVQRVVFYFAEALRERIERETGSIPSKAKEMSISGHGLSTNP-TYIACHQEVPFHS 364
                         699***************************************************77777666655555543344443.444466778**** PP

                GRAS  93 fshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegpp.slRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlv 182
                         + ++t  qaI e+v+ e++vH iD++i  G+QW  L+++La+R+e p   l iT+vg      k+++eetg+rL+++Ae+l++pf+f++++
  Prupe.8G266100.1.p 365 VMQFTGIQAIIESVSLESKVHLIDLEIRSGVQWTGLMESLAEREECPVeLLTITAVGV---AGKQKIEETGKRLTSVAESLNIPFQFKAVI 452
                         ********************************************7666489*******...589*************************** PP

                GRAS 183 akrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdslea 273
                          +++ed++ + ++v+ +Ea+aV   l l ++ +++ +le+    +++++++l P ++vv+e e++hns+sF++rf++al yysa+fd+le+
  Prupe.8G266100.1.p 453 ISAMEDIKDQLFDVEDDEAVAVYAPLILRTMISRPSCLEN----LMRVMRNLTPCIMVVIEVEVNHNSPSFVNRFIDALFYYSAFFDCLET 539
                         ********************************88888888....*********************************************** PP

                GRAS 274 klpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkd 364
                          +  ++ee +++ + l+++ i+n+va+eg+er++r  ++  Wr+ + ++ + ++++s+    qa+ll ++++    +++ + ++l+ gWk+
  Prupe.8G266100.1.p 540 CM--KQEEYRVLTEDLFREGIRNIVAAEGSERVARSVKMDVWRAFFARFRMVEMNFSNASLYQASLLAKRFGCPSCTLDRNGKCLTVGWKG 628
                         *6..677778888888********************************************************999**************** PP

                GRAS 365 rpLvsvSaWr 374
                          p+ svSaW+
  Prupe.8G266100.1.p 629 TPIHSVSAWK 638
                         *********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098541.778248618IPR005202Transcription factor GRAS
PfamPF035144.6E-85275638IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 641 aa     Download sequence    Send to blast
MANAFFPFTP FDFGVLGGLT PQLEDYEKDQ EVAFKVKPGH LFAIEELGLG EMDSSLSSEH  60
GFYQEDSKAK KGGLSHFSKD PEPTYSLSDN FNFDIVSSEH GFQQSNKSEK GLAHLSKDQD  120
HHHYQQHPHY QQQQPKSNYS ILDNFNFDSA FPPAHPIQDG THQFTYNQIG GSDIAETNKH  180
LPHQSSLAVL ELLNSYGSAF KNLRGERTSS NTGNEAEASS YVGQQKLSTE EIMRVAGARY  240
VQFSNQGYGD FYPLHPFGYA LSGLSEEETK DAELAHILLA AAEKVGYQQF ERANRLLLRC  300
EWIASFKGNP VQRVVFYFAE ALRERIERET GSIPSKAKEM SISGHGLSTN PTYIACHQEV  360
PFHSVMQFTG IQAIIESVSL ESKVHLIDLE IRSGVQWTGL MESLAEREEC PVELLTITAV  420
GVAGKQKIEE TGKRLTSVAE SLNIPFQFKA VIISAMEDIK DQLFDVEDDE AVAVYAPLIL  480
RTMISRPSCL ENLMRVMRNL TPCIMVVIEV EVNHNSPSFV NRFIDALFYY SAFFDCLETC  540
MKQEEYRVLT EDLFREGIRN IVAAEGSERV ARSVKMDVWR AFFARFRMVE MNFSNASLYQ  600
ASLLAKRFGC PSCTLDRNGK CLTVGWKGTP IHSVSAWKFR *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A6e-3630463833375GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007199314.10.0hypothetical protein PRUPE_ppa023374mg
TrEMBLM5VUD50.0M5VUD5_PRUPE; Uncharacterized protein
STRINGVIT_07s0005g01500.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF47933162
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66350.14e-50RGA-like 1