PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.8G255600.1.p
Common NamePRUPE_ppa000815mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family HB-other
Protein Properties Length: 982aa    MW: 109176 Da    PI: 8.7704
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.8G255600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox19.22.1e-0670126157
                         TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
            Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                         +r+R  ++++ ++ ++++F  +  +s++e +eL++  g+t +qV+ +F  +R + +k
  Prupe.8G255600.1.p  70 KRPRDLLNPKAIKYMQSVFSIKDAISKKESRELSALFGVTGTQVRDFFNSQRSRVRK 126
                         799**************************************************9997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500719.84767127IPR001356Homeobox domain
SMARTSM003898.6E-469131IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.9E-569137IPR009057Homeodomain-like
SuperFamilySSF466891.84E-669130IPR009057Homeodomain-like
CDDcd000867.70E-470126No hitNo description
Gene3DG3DSA:1.20.930.101.3E-5227318IPR017923Transcription factor IIS, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006351Biological Processtranscription, DNA-templated
GO:0009911Biological Processpositive regulation of flower development
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 982 aa     Download sequence    Send to blast
MEDLSEMEIG SSVESFQKFL DSQRQLFHSQ IDQLQKVVVT QCNLTGVNPL SQEMAAGALS  60
VKIDGPFAGK RPRDLLNPKA IKYMQSVFSI KDAISKKESR ELSALFGVTG TQVRDFFNSQ  120
RSRVRKLVQL SREKATRSSE HKELQDGVST SSDPLTPIDP VPLNSVGPSS VEDAPSCSTQ  180
DDALSGLDDL DKHFVDNIFN LMRKEETFSG QEKLMEWILQ IQNSSVLCWF LNTGGVMILA  240
TWLSQAAIEE QTSVLLVILK VLCHLPLHKA LPVHMSAILQ SVNRLRFYRT ADVSNRARVL  300
LSRWSKLLAR IQNMKKPNGM KTSSDSQHEL VMLKQSIDEV MGDESWKSNI DIPEDIFATP  360
FENAENSRRS EASEPLKLLT ASSDESNKKQ ILGVSSSQFR ARRKVQLVEQ PGQKSAGRSV  420
QVTRATPVSK GRPMSADDIQ KAKMRAQFMQ SKYGKSGSSN ENKELKTEGG NKLSTSQDSI  480
LPVVPKVPVR PNIEEPKKPV TLLLKERETP NRLETSLAPK LRMDLKESIL EKCQRIRVPW  540
KTPPEIKLDP EWRVGGGENG KEIEVQRNRN HREKETIYQR VQDIPSNPKE PWDIEMDYDD  600
SLTPEIPIEQ PPDADGTETH SLSREGNNAQ TWVASSQGVN SAASLAPALS QMNGASAAAE  660
PDLELLAVLL KNPELVFALT SGQAANLSSE DTVKLLDMIK SGGAGNLNGL GRKMEQRVEV  720
SLPSPTPSSN PGTSGWRADA GRNAFPQQMA TTNNSSVSSS VHMIPSQRLS TSQPAVPSYS  780
PDYFPPSMQT PAASEMVLTM KNTHLNNLSN SYNVAERQPN SFPTPLVSTP ARQQRQPQPL  840
QQPRFSEPRL PTHMYPSKPQ MGKPGPPPPS DSWRARQDVP SNYHYLENQN QYNASHGGPL  900
QQPQLLPGPS WERNEHVGGN QDFESWSPDN SPTRNPGYMY GREPRMNPAR DYMPDRSRQM  960
NPSGYGGQNR LGNRWPDRGR H*
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Accumulates prior to flowering in the vegetative shoot apical meristem and after flowering in floral meristems.
UniprotTISSUE SPECIFICITY: Expressed in shoot apex, root apex, leaf primordia and floral buds.
Functional Description ? help Back to Top
Source Description
UniProtSeems to play a role in the regulation of flowering time in the autonomous flowering pathway by repressing FLOWERING LOCUS C expression. {ECO:0000269|PubMed:10363371}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.8G255600.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020426187.10.0homeobox protein LUMINIDEPENDENS isoform X1
SwissprotQ387960.0LUMI_ARATH; Homeobox protein LUMINIDEPENDENS
TrEMBLA0A251N3G30.0A0A251N3G3_PRUPE; Uncharacterized protein
STRINGXP_008235014.10.0(Prunus mume)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF98092934
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G02560.20.0HB-other family protein
Publications ? help Back to Top
  1. Chakrabortee S, et al.
    Luminidependens (LD) is an Arabidopsis protein with prion behavior.
    Proc. Natl. Acad. Sci. U.S.A., 2016. 113(21): p. 6065-70
    [PMID:27114519]