PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.8G232800.1.p
Common NamePRUPE_ppa005367mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family bZIP
Protein Properties Length: 465aa    MW: 50693.3 Da    PI: 6.3503
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.8G232800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_149.96.8e-16239295359
                         XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevakl 59 
                         ++kr+rr+ +NRe+ArrsR+RK+a++ eLe+ v +L  e ++L k+l   ++++++ 
  Prupe.8G232800.1.p 239 DVKRARRMLSNRESARRSRRRKQAQMSELETQVGQLRVEHSTLLKRLTDVNQKYDNA 295
                         68********************************************99999998865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1705.2E-11236292No hitNo description
SMARTSM003382.5E-18237301IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.047239293IPR004827Basic-leucine zipper domain
SuperFamilySSF579599.64E-11240292No hitNo description
PfamPF001702.4E-13240293IPR004827Basic-leucine zipper domain
PROSITE patternPS000360244259IPR004827Basic-leucine zipper domain
PfamPF124988.0E-29308430IPR020983Basic leucine-zipper, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000693Biological Processpositive regulation of seed maturation
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 465 aa     Download sequence    Send to blast
MHSVFSVDDV SDTAWALSSP AMNRSASEWA FEQFLDEFST PAATPRRSVA VADQLTASSV  60
ASCSVASQSS TSKREDGDEE VVEIKKPDHH NHHHQPQQQL NHPPPPPLDP TSTVQVNSDQ  120
YREFLKNQLD LACAAVALSR ASSLKPVDLG NMAAESQSQL SKPSQLAHSQ SLDKDAGHGF  180
PVQQNEADTS PLGIPALPAV QKITGLQSKQ TTSGSSKEDS DDDDLEGDIE INENMDPSDV  240
KRARRMLSNR ESARRSRRRK QAQMSELETQ VGQLRVEHST LLKRLTDVNQ KYDNAAVDNR  300
ILRADIETLR AKVKMAEDSV KRVTGINPLL LAMSNLPSVS IPSVNPMDGS TNAAVPMQPN  360
SNQLFHPVVP NLATSTLPHQ RLDTGFPRDP PISLVRNQQS NVGQPTVSGS NMAEISSIQH  420
TASVDHMQQQ PQQQQLRPGV GPREPLPGWD PQLSHAVPKN KKQS*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1253260RRSRRRKQ
2255260SRRRKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppe.10831e-164fruit
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.8G232800.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007199824.10.0light-inducible protein CPRF2 isoform X1
TrEMBLM5VVS70.0M5VVS7_PRUPE; Uncharacterized protein
STRINGEMJ010230.0(Prunus persica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF136911825
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54620.17e-51basic leucine zipper 25