PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.8G174800.1.p
Common NamePRUPE_ppa009455mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family NAC
Protein Properties Length: 292aa    MW: 33889.7 Da    PI: 7.1307
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.8G174800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM151.15.3e-47181443128
                 NAM   3 pGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                         pGfrFhPt+eel+ +yLk  v gk+ ++ ++i  ++iy+++PwdLp   k +e+ewyfF++rd+k+ +g r+nr+t++g+Wkatg+d++++
  Prupe.8G174800.1.p  18 PGFRFHPTEEELLEFYLKSVVFGKRQRF-DIIGFLNIYHHDPWDLPGLSKIGEREWYFFVPRDRKHGSGGRPNRTTETGFWKATGSDRKIV 107
                         9************************888.99***************8778899*************************************9 PP

                 NAM  94 sk..kgelvglkktLvfykgrapkgektdWvmheyrl 128
                         s    ++ +gl+ktLvfykgrap+g+ktdWvm+eyrl
  Prupe.8G174800.1.p 108 SLsdPKRIIGLRKTLVFYKGRAPRGTKTDWVMNEYRL 144
                         97666778***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.96E-5616162IPR003441NAC domain
PROSITE profilePS5100554.23716162IPR003441NAC domain
PfamPF023651.1E-2418144IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009965Biological Processleaf morphogenesis
GO:0010200Biological Processresponse to chitin
GO:0045792Biological Processnegative regulation of cell size
GO:0048281Biological Processinflorescence morphogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
MAANTKDQEQ MTPEFELPGF RFHPTEEELL EFYLKSVVFG KRQRFDIIGF LNIYHHDPWD  60
LPGLSKIGER EWYFFVPRDR KHGSGGRPNR TTETGFWKAT GSDRKIVSLS DPKRIIGLRK  120
TLVFYKGRAP RGTKTDWVMN EYRLPDNCHY LKDIVLCKIY RKATSLKVLE QRAAMEEEIK  180
NFHPSPNTSS PPTSMETISF CSQSQEDLTL QMPKNYVVLK QEMDDASLTE EKEPKEEKAM  240
EIKGSPPPPT YILPEIQVPR LSVDWTQDAF WTQMNSPWLQ NLTPLPNLLN F*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A5e-461816217168Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds sequence-specific DNA motifs. Involved in stress response. Plays a positive role in drought and salt stress tolerance through the modulation of abscisic acid-mediated signaling. {ECO:0000269|PubMed:26834774}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.8G174800.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by drought stress, salt stress and abscisic acid (ABA). {ECO:0000269|PubMed:26834774}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007200527.10.0NAC domain-containing protein 35
SwissprotQ10S652e-96NAC22_ORYSJ; NAC domain-containing protein 22
TrEMBLM5VLG70.0M5VLG7_PRUPE; Uncharacterized protein
STRINGEMJ017260.0(Prunus persica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF62143251
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G17040.11e-106NAC domain containing protein 36
Publications ? help Back to Top
  1. Hong Y,Zhang H,Huang L,Li D,Song F
    Overexpression of a Stress-Responsive NAC Transcription Factor Gene ONAC022 Improves Drought and Salt Tolerance in Rice.
    Front Plant Sci, 2016. 7: p. 4
    [PMID:26834774]