PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.8G165400.7.p
Common NamePRUPE_ppa009913mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family bZIP
Protein Properties Length: 273aa    MW: 29409.7 Da    PI: 6.7672
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.8G165400.7.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_128.72.9e-0992138551
                         CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkelee 51 
                         k  +r   NReA r++R++Kka+ + Le++v  L + N++L k+l+ 
  Prupe.8G165400.7.p  92 KSKKRPLGNREAVRKYREKKKARAASLEDEVVRLRTLNQQLLKRLQG 138
                         77889999**********************************99974 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1705.7E-1486156No hitNo description
SMARTSM003382.6E-1087155IPR004827Basic-leucine zipper domain
PfamPF077168.0E-1490145IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.09490137IPR004827Basic-leucine zipper domain
SuperFamilySSF579598.13E-792138No hitNo description
CDDcd146869.56E-1394147No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0071294Biological Processcellular response to zinc ion
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 273 aa     Download sequence    Send to blast
MEDGELDFSN QEMFSGPNMG GEHPSSCSMD SFFDDLLKDT HACTHTHTCN PPGPDYSHTH  60
TCFHVHTKIV SSATGSEDKA GTDDTAESGE KKSKKRPLGN REAVRKYREK KKARAASLED  120
EVVRLRTLNQ QLLKRLQGQA ALEAEIARLK CLLVDIRGRI EGEIGSFPYQ KSVNPNLPNP  180
NIPSAYVMNP CNLQRDDQLY CLHQGADGKC GDGAVMNGQG FSGCDFENLQ CLVNQDGGYK  240
ELSGCGLGNG VSNGNSSATN KRKGGARAAA AN*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppe.195610.0fruit
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in the response to zinc ion deficiency. Binds to the consensus sequence 5'-[AG]TGTCGACA[CT]-3' also called zinc deficiency response element (ZDRE). The ZDRE sequence is conserved in the plant kingdom and present in the promoters of genes that constitute the primary response to zinc deficiency, comprising additional ZIP metal transporter genes (PubMed:20479230, PubMed:26306426). Required for zinc accumulation in roots. Mediates the expression of the zinc transporters ZIP3, ZIP4, ZIP5 and ZIP9 during growth in zinc-deficient conditions. ZIP9 transporter is involved in zinc uptake in roots (PubMed:26306426). {ECO:0000269|PubMed:20479230, ECO:0000269|PubMed:26306426}.
UniProtTranscription factor involved in the response to zinc ion deficiency. Binds to the consensus sequence 5'-[AG]TGTCGACA[CT]-3' also called zinc deficiency response element (ZDRE). The ZDRE sequence is conserved in the plant kingdom and present in the promoters of genes that constitute the primary response to zinc deficiency, comprising additional ZIP metal transporter genes (PubMed:20479230, PubMed:26306426). Required for zinc accumulation in roots. Mediates the expression of the zinc transporter ZIP12 during growth in zinc-deficient conditions. ZIP12 transporter is involved in zinc uptake in roots (PubMed:26306426). {ECO:0000269|PubMed:20479230, ECO:0000269|PubMed:26306426}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.8G165400.7.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by zinc deficiency. {ECO:0000269|PubMed:20479230}.
UniProtINDUCTION: Induced by zinc deficiency. {ECO:0000269|PubMed:20479230}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007201303.10.0basic leucine zipper 23
RefseqXP_020425383.10.0basic leucine zipper 23
RefseqXP_020425384.10.0basic leucine zipper 23
RefseqXP_020425386.10.0basic leucine zipper 23
SwissprotQ8GTS21e-114BZP23_ARATH; Basic leucine zipper 23
SwissprotQ8VY761e-113BZP19_ARATH; Basic leucine zipper 19
TrEMBLM5VMR70.0M5VMR7_PRUPE; Uncharacterized protein
STRINGEMJ025020.0(Prunus persica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35040.14e-96bZIP family protein
Publications ? help Back to Top
  1. Azevedo H, et al.
    Transcriptomic profiling of Arabidopsis gene expression in response to varying micronutrient zinc supply.
    Genom Data, 2016. 7: p. 256-8
    [PMID:26981422]
  2. Castro PH, et al.
    Phylogenetic analysis of F-bZIP transcription factors indicates conservation of the zinc deficiency response across land plants.
    Sci Rep, 2017. 7(1): p. 3806
    [PMID:28630437]
  3. Henriques AR,Farias DDR,Costa de Oliveira A
    Identification and characterization of the bZIP transcription factor involved in zinc homeostasis in cereals.
    Genet. Mol. Res., 2017.
    [PMID:28671251]
  4. Nazri AZ,Griffin JHC,Peaston KA,Alexander-Webber DGA,Williams LE
    F-group bZIPs in barley-a role in Zn deficiency.
    Plant Cell Environ., 2017. 40(11): p. 2754-2770
    [PMID:28763829]
  5. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]