PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.8G126600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family bZIP
Protein Properties Length: 422aa    MW: 45790.4 Da    PI: 10.4296
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.8G126600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1452.4e-14343393555
                         CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55 
                         +r+rr++kNRe+A rsR+RK+a++ eLe +v++L++ N++L+ +  e+ ++
  Prupe.8G126600.1.p 343 RRQRRMIKNRESAARSRARKQAYTLELEAEVAKLKEMNEELQRKQTEIMEM 393
                         79************************************9998877777666 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.3E-11339404IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.76341392IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1704.2E-14343392No hitNo description
SuperFamilySSF579593.73E-10343391No hitNo description
CDDcd147071.57E-25343397No hitNo description
PfamPF001702.7E-12343393IPR004827Basic-leucine zipper domain
PROSITE patternPS000360346361IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0009738Biological Processabscisic acid-activated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0000976Molecular Functiontranscription regulatory region sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 422 aa     Download sequence    Send to blast
MGSNFNFKNF GDAPPGEGNG GKAAGNFTLA RQPSVYSLTF DEFQNTIGGL GKDFGSMNMD  60
ELLKNIWTAE ETQGVTSTSG AGEGSAPGGN LQRQGSLTLP RTLSQKTVDE VWKDLIRETS  120
DAKYNTVAMG SNLPQRQQTL GEMTLEEFLV RAGVVREDVQ PVVRPNNSGF YGELYRPNNH  180
NGLAPGFQQP SRTNGLLGNR VADNNNSVLN VGGVRSSQQQ TQQLPPQQQP LFPKPTNVAF  240
APSMHLTNNA QLTSPRTRGP MTGVVEPSMN TVFTQVGGFP GAGIGMTGLG TGGGAVAARS  300
PTNQISPDVI AKSSGDTSSL SPVPYMFSRG RKSNGALEKV VERRQRRMIK NRESAARSRA  360
RKQAYTLELE AEVAKLKEMN EELQRKQTEI MEMQKDQILE TVKRQRGGKR QCLRRTLTGP  420
W*
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots and flowers. {ECO:0000269|PubMed:11884679}.
Functional Description ? help Back to Top
Source Description
UniProtBinds to the ABA-responsive element (ABRE). Mediates stress-responsive ABA signaling. {ECO:0000269|PubMed:11884679, ECO:0000269|PubMed:15361142}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00038PBMTransfer from AT4G34000Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.8G126600.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated by drought, salt, abscisic acid (ABA). {ECO:0000269|PubMed:10636868, ECO:0000269|PubMed:16284313}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020426016.10.0ABSCISIC ACID-INSENSITIVE 5-like protein 7
RefseqXP_020426017.10.0ABSCISIC ACID-INSENSITIVE 5-like protein 7
SwissprotQ9M7Q31e-112AI5L6_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 6
TrEMBLA0A251MWZ90.0A0A251MWZ9_PRUPE; Uncharacterized protein
STRINGXP_008236589.10.0(Prunus mume)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF19623481
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G34000.22e-99abscisic acid responsive elements-binding factor 3
Publications ? help Back to Top
  1. Zhao Q, et al.
    Regulation and function of Arabidopsis AtGALK2 gene in abscisic acid response signaling.
    Mol. Biol. Rep., 2018.
    [PMID:24078097]
  2. Bao Y, et al.
    The tumor necrosis factor receptor-associated factor (TRAF)-like family protein SEVEN IN ABSENTIA 2 (SINA2) promotes drought tolerance in an ABA-dependent manner in Arabidopsis.
    New Phytol., 2014. 202(1): p. 174-87
    [PMID:24350984]
  3. González-Grandío E,Cubas P
    Identification of gene functions associated to active and dormant buds in Arabidopsis.
    Plant Signal Behav, 2014. 9(2): p. e27994
    [PMID:24518068]
  4. Xie M, et al.
    AtWNK9 is regulated by ABA and dehydration and is involved in drought tolerance in Arabidopsis.
    Plant Physiol. Biochem., 2014. 77: p. 73-83
    [PMID:24561249]
  5. Kim EY,Seo YS,Park KY,Kim SJ,Kim WT
    Overexpression of CaDSR6 increases tolerance to drought and salt stresses in transgenic Arabidopsis plants.
    Gene, 2014. 552(1): p. 146-54
    [PMID:25234727]
  6. Zhang H, et al.
    The RING finger ubiquitin E3 ligase SDIR1 targets SDIR1-INTERACTING PROTEIN1 for degradation to modulate the salt stress response and ABA signaling in Arabidopsis.
    Plant Cell, 2015. 27(1): p. 214-27
    [PMID:25616872]
  7. Baek D, et al.
    A Role for Arabidopsis miR399f in Salt, Drought, and ABA Signaling.
    Mol. Cells, 2016. 39(2): p. 111-8
    [PMID:26674968]
  8. Bao Y, et al.
    Overexpression of the NDR1/HIN1-Like Gene NHL6 Modifies Seed Germination in Response to Abscisic Acid and Abiotic Stresses in Arabidopsis.
    PLoS ONE, 2016. 11(2): p. e0148572
    [PMID:26849212]
  9. Gao S, et al.
    ABF2, ABF3, and ABF4 Promote ABA-Mediated Chlorophyll Degradation and Leaf Senescence by Transcriptional Activation of Chlorophyll Catabolic Genes and Senescence-Associated Genes in Arabidopsis.
    Mol Plant, 2016. 9(9): p. 1272-1285
    [PMID:27373216]
  10. Li X, et al.
    Dual Function of NAC072 in ABF3-Mediated ABA-Responsive Gene Regulation in Arabidopsis.
    Front Plant Sci, 2016. 7: p. 1075
    [PMID:27486475]
  11. Wang Z, et al.
    Overexpressing Arabidopsis ABF3 increases tolerance to multiple abiotic stresses and reduces leaf size in alfalfa.
    Plant Physiol. Biochem., 2016. 109: p. 199-208
    [PMID:27721135]
  12. Song L, et al.
    A transcription factor hierarchy defines an environmental stress response network.
    Science, 2017.
    [PMID:27811239]
  13. Kerr TCC, et al.
    Ectopic expression of two AREB/ABF orthologs increases drought tolerance in cotton (Gossypium hirsutum).
    Plant Cell Environ., 2018. 41(5): p. 898-907
    [PMID:28098349]
  14. Lyzenga WJ,Sullivan V,Liu H,Stone SL
    The Kinase Activity of Calcineurin B-like Interacting Protein Kinase 26 (CIPK26) Influences Its Own Stability and that of the ABA-regulated Ubiquitin Ligase, Keep on Going (KEG).
    Front Plant Sci, 2017. 8: p. 502
    [PMID:28443108]
  15. Song C,Kim T,Chung WS,Lim CO
    The Arabidopsis Phytocystatin AtCYS5 Enhances Seed Germination and Seedling Growth under Heat Stress Conditions.
    Mol. Cells, 2017. 40(8): p. 577-586
    [PMID:28756655]
  16. Fernando VCD,Al Khateeb W,Belmonte MF,Schroeder DF
    Role of Arabidopsis ABF1/3/4 during det1 germination in salt and osmotic stress conditions.
    Plant Mol. Biol., 2018. 97(1-2): p. 149-163
    [PMID:29680877]
  17. Kim HJ, et al.
    Confirmation of Drought Tolerance of Ectopically Expressed AtABF3 Gene in Soybean.
    Mol. Cells, 2018. 41(5): p. 413-422
    [PMID:29754472]