PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.8G091800.7.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family MYB_related
Protein Properties Length: 731aa    MW: 80567.3 Da    PI: 4.6953
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.8G091800.7.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding21.55.4e-07587630246
                         SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                          rW++++ el++ a++q G++ ++ I +    gRt+ q+k+++ k
  Prupe.8G091800.7.p 587 VRWSKQDTELFYGAIQQCGSD-FTMIQELYFPGRTRHQIKLKFKK 630
                         69*******************.*****98766**********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF159639.3E-27579666No hitNo description
SMARTSM007172.1E-4585634IPR001005SANT/Myb domain
CDDcd001671.71E-4588630No hitNo description
SuperFamilySSF466892.69E-9588636IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.1E-5588630IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 731 aa     Download sequence    Send to blast
MEDLDDIFLD PSNAPARPGG RFRPKAKPRP SKVASTAATS ALPNDRTEKP ATLSPTVSDT  60
VPSVKSIDVG DVKVTDPVGS SLATSEILGN IEPAKNNENL CTNVASSDGN KDTKPCESAA  120
TAAPQPEVAA SVGTAAGENA DIFSGLECLD GFLSQTTRGT ESAASKPHVS AESSAFMVCD  180
VAEAQTFSDC CTTQDPVSCR EVSVSNKPDE VQLETKVDGA FSEFEVLDVV SDATILSGQR  240
VGKFQPKLKV KKGKEHLHIP PAEVECMLSQ AVLVPSETDM NESSLPAFPP GHVLDHPSPR  300
FGDSSTPHPT SDPLVNTEYI AETTHLDGAI FGDAVRSEDV GGTLGKEGHK SRNRKGSTAS  360
NHSQKHKSFA ASEEAEGGTS SRKLRKRLPR QEVEELVHEA NEDSFTAEPS SGSNVNEDEN  420
NDNEYREHKT SQRKRAPRKS KEPESGKEEP VKKRKRAKEA PDKSTKDPPK RFSHSTRRTK  480
RHVDKSLLEI PEDEIDHQSL SLKNLIRLAE HRELLAIKEA RKMTTPVPDE STNNDSHKEA  540
NHDEENEEET FPSEQDRNSE ENQASYRVNA SSFLLNYQSY MDKTPTVRWS KQDTELFYGA  600
IQQCGSDFTM IQELYFPGRT RHQIKLKFKK EERQNPLRIN EAVLSRSTCS TDHSQFTSYI  660
ERLQQVAQAN KEEEAEPTHD TDEGVKKTEL EEPEDQEADV AEVQEEAVDA EVENPLKSDE  720
IDDEEFTWSE *
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1432454RKRAPRKSKEPESGKEEPVKKRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008364969.10.0PREDICTED: protein SPP41-like isoform X2
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G39160.11e-41MYB_related family protein