PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.8G035500.1.p
Common NamePRUPE_ppa006028mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family NAC
Protein Properties Length: 433aa    MW: 48337 Da    PI: 4.279
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.8G035500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM155.91.8e-4861341129
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkd 89 
                         l+pGfrF+Ptd elv++yLk+k+ gk+l + +vi+evdiyk++PwdLp k + + ++ +wyfF++r+kky++g+r +rat+ gyWk+tgkd
  Prupe.8G035500.1.p   6 LAPGFRFKPTDVELVQYYLKRKLLGKRLGF-KVIAEVDIYKYDPWDLPdKsCWDCGDLKWYFFCPREKKYRSGNRIQRATEGGYWKTTGKD 95 
                         579************************999.99**************96345666888********************************* PP

                 NAM  90 kevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                         ++vl  +ge vg  ktL+f++grap+g +t+Wvmheyrle
  Prupe.8G035500.1.p  96 RSVLY-SGEIVGWIKTLIFHTGRAPSGDRTNWVMHEYRLE 134
                         *****.999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.44E-573156IPR003441NAC domain
PROSITE profilePS5100554.7596156IPR003441NAC domain
PfamPF023655.6E-258133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 433 aa     Download sequence    Send to blast
MGKSSLAPGF RFKPTDVELV QYYLKRKLLG KRLGFKVIAE VDIYKYDPWD LPDKSCWDCG  60
DLKWYFFCPR EKKYRSGNRI QRATEGGYWK TTGKDRSVLY SGEIVGWIKT LIFHTGRAPS  120
GDRTNWVMHE YRLEDQGLAD RGVPLDSYVL CMIFQKEGLG PRIGAQYGAP FKEEDWSDDE  180
VEITSEAVQV AITPEPDLGL PCNNVSPTAT NAHYVGDIGI GPSGSGIYDI LPPFCEVSQP  240
VSSNYVTLEM PLASVGDDII SMFDCFTEES TLYIDEPKKV ESEGRLETAQ NANMPSTHSP  300
EVICAGPSFE SCGFDVLRPC NVNESVSCNF VTMENPPASN GDETLPIMDC FAEESAFLVN  360
DNGKNEELNN PEHFGNATPH FNTSNIYEDL GDLENLGRVG EVGYNFCSEP DSRSHFLELY  420
DLDQPQHPNL FF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-45515716166NO APICAL MERISTEM PROTEIN
1ut4_B3e-45515716166NO APICAL MERISTEM PROTEIN
1ut7_A3e-45515716166NO APICAL MERISTEM PROTEIN
1ut7_B3e-45515716166NO APICAL MERISTEM PROTEIN
3swm_A3e-45515719169NAC domain-containing protein 19
3swm_B3e-45515719169NAC domain-containing protein 19
3swm_C3e-45515719169NAC domain-containing protein 19
3swm_D3e-45515719169NAC domain-containing protein 19
3swp_A3e-45515719169NAC domain-containing protein 19
3swp_B3e-45515719169NAC domain-containing protein 19
3swp_C3e-45515719169NAC domain-containing protein 19
3swp_D3e-45515719169NAC domain-containing protein 19
4dul_A3e-45515716166NAC domain-containing protein 19
4dul_B3e-45515716166NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppe.25710.0fruit
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in the epidermal cells of the root apical region. {ECO:0000269|PubMed:20388856}.
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator that binds specific DNA sequences on the promoter regions of target genes. {ECO:0000250|UniProtKB:Q9C8W9}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00583DAPTransfer from AT5G64060Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.8G035500.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007201045.10.0NAC domain-containing protein 82
SwissprotQ9FY826e-88NAC82_ARATH; NAC domain-containing protein 82
TrEMBLM5VM480.0M5VM48_PRUPE; Uncharacterized protein
STRINGEMJ022440.0(Prunus persica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF33023465
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G64060.11e-87NAC domain containing protein 103
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Deeken R, et al.
    Identification of Arabidopsis thaliana phloem RNAs provides a search criterion for phloem-based transcripts hidden in complex datasets of microarray experiments.
    Plant J., 2008. 55(5): p. 746-59
    [PMID:18485061]
  3. Ohbayashi I, et al.
    Evidence for a Role of ANAC082 as a Ribosomal Stress Response Mediator Leading to Growth Defects and Developmental Alterations in Arabidopsis.
    Plant Cell, 2017. 29(10): p. 2644-2660
    [PMID:28899981]