PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.8G035400.1.p
Common NamePRUPE_ppa007941mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family NAC
Protein Properties Length: 352aa    MW: 39402.1 Da    PI: 4.8764
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.8G035400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM155.62.1e-4861341129
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkd 89 
                         l+pGfrF+Ptd elv++yLk+k+ gk+l + +vi+evdiyk++PwdLp k + ++++ + yfF++r+kky++g+r +rat+ gyWk+tgkd
  Prupe.8G035400.1.p   6 LAPGFRFKPTDVELVQYYLKRKLLGKRLGF-KVIAEVDIYKYDPWDLPdKsCWESGDLKRYFFCPREKKYRNGNRIQRATEGGYWKTTGKD 95 
                         579************************999.99**************9644667778899******************************* PP

                 NAM  90 kevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                         ++vl  +ge+vg  ktL+f++grap+g +t+Wvmheyrle
  Prupe.8G035400.1.p  96 RSVLY-SGEVVGWIKTLIFHTGRAPRGDRTNWVMHEYRLE 134
                         *****.999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.97E-573156IPR003441NAC domain
PROSITE profilePS5100553.4996156IPR003441NAC domain
PfamPF023652.6E-248133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 352 aa     Download sequence    Send to blast
MGKSSLAPGF RFKPTDVELV QYYLKRKLLG KRLGFKVIAE VDIYKYDPWD LPDKSCWESG  60
DLKRYFFCPR EKKYRNGNRI QRATEGGYWK TTGKDRSVLY SGEVVGWIKT LIFHTGRAPR  120
GDRTNWVMHE YRLEDQGLAD RGVPLDSYVI CMIFQKDGLG PKIGAQYGAP FKEEDWTDDE  180
VEICSEAIPH ENMSEPNLVV PSNCNSSITT SGHTPKGIHT SPSESCISDV LPPSCNVHQL  240
VSSNHVTMEK LHGSDDDILS MLNCFTEGST SLMKENDKNE ELGNVIPSGN ASATPNFNSD  300
DIYEGLGDLG KMARVSEDGY NFSNVHNSIF APAQMQLGDN EQFLELDDLS W*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-45515614168Stress-induced transcription factor NAC1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppe.25710.0fruit
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00583DAPTransfer from AT5G64060Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.8G035400.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016650765.10.0PREDICTED: NAC domain-containing protein 82-like
TrEMBLM5VNW30.0M5VNW3_PRUPE; Uncharacterized protein
STRINGEMJ025910.0(Prunus persica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF33023465
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G64060.14e-89NAC domain containing protein 103