PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.8G035300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family NAC
Protein Properties Length: 352aa    MW: 39171.9 Da    PI: 5.1297
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.8G035300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM156.11.5e-4861341129
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkd 89 
                         lppGfrF+Ptd elv +yLk+kv gk+l+  ++i+evdi+k+ PwdLp k   ++++ +wyfF+++++ky+tg r +r t+ gyWk+tgkd
  Prupe.8G035300.1.p   6 LPPGFRFSPTDVELVRYYLKRKVMGKRLHS-NFIAEVDIHKYAPWDLPeKsGWQSGDLKWYFFCPTARKYPTGVRVQRGTECGYWKSTGKD 95 
                         79*************************999.89**************94345566778********************************* PP

                 NAM  90 kevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                         ++vl  +ge+ g kk+L+f+kgr+pkge+tdWvmheyrle
  Prupe.8G035300.1.p  96 RSVLY-NGEVSGWKKILIFHKGRSPKGERTDWVMHEYRLE 134
                         *****.999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019418.11E-573156IPR003441NAC domain
PROSITE profilePS5100554.2736156IPR003441NAC domain
PfamPF023658.2E-257133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 352 aa     Download sequence    Send to blast
MGKPPLPPGF RFSPTDVELV RYYLKRKVMG KRLHSNFIAE VDIHKYAPWD LPEKSGWQSG  60
DLKWYFFCPT ARKYPTGVRV QRGTECGYWK STGKDRSVLY NGEVSGWKKI LIFHKGRSPK  120
GERTDWVMHE YRLEAKDLAD SGVPHDSYVI CMIFHKDGWG PKNGAQYGAP FKEEDWTDDE  180
AEICSEAVPH ENMPEPNLVV QSNCNSSVTT SGHSPKDIHL GPSESCISDV LPPSCNALQL  240
VSSNHVTMEK LRGSGDDILP MLNCFTEGST SLMKVNDKNE ELGNVIHSGN ASATPNVNGD  300
DIYEDLGDLG KMAGVSEDGF YFSNVHNSIC APAQMQLGDN DQFLELDDLS W*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-43615615168Stress-induced transcription factor NAC1
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in the epidermal cells of the root apical region. {ECO:0000269|PubMed:20388856}.
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator that binds specific DNA sequences on the promoter regions of target genes. {ECO:0000250|UniProtKB:Q9C8W9}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.8G035300.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020426054.10.0NAC domain-containing protein 82
SwissprotQ9FY823e-90NAC82_ARATH; NAC domain-containing protein 82
TrEMBLA0A251MSC80.0A0A251MSC8_PRUPE; Uncharacterized protein
STRINGEMJ058870.0(Prunus persica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF33023465
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G09330.41e-92NAC domain containing protein 82
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Deeken R, et al.
    Identification of Arabidopsis thaliana phloem RNAs provides a search criterion for phloem-based transcripts hidden in complex datasets of microarray experiments.
    Plant J., 2008. 55(5): p. 746-59
    [PMID:18485061]
  3. Ohbayashi I, et al.
    Evidence for a Role of ANAC082 as a Ribosomal Stress Response Mediator Leading to Growth Defects and Developmental Alterations in Arabidopsis.
    Plant Cell, 2017. 29(10): p. 2644-2660
    [PMID:28899981]