PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.7G262600.1.p
Common NamePRUPE_ppa004042mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family WRKY
Protein Properties Length: 534aa    MW: 58781.1 Da    PI: 5.4015
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.7G262600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY76.23.8e-24221277259
                         --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                         +DgynWrKYGqK+vk+ + +rsYYrCt+++C +kk +e++++ + v+ei+Y+++H+he
  Prupe.7G262600.1.p 221 SDGYNWRKYGQKQVKSPQGSRSYYRCTYSECYAKK-IECCDHSGYVTEIVYKSQHTHE 277
                         7********************************98.*********************8 PP

2WRKY97.58.9e-31396452359
                         -SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                WRKY   3 DgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                         Dgy+WrKYGqK+vkg+++pr+YYrCtsagCpv+k++e++ +++++v+itY+g H+h+
  Prupe.7G262600.1.p 396 DGYRWRKYGQKMVKGNPHPRNYYRCTSAGCPVRKHIETAIDNTSAVIITYKGIHDHD 452
                         9*******************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.9E-20217279IPR003657WRKY domain
SuperFamilySSF1182901.44E-19219279IPR003657WRKY domain
SMARTSM007741.3E-22220278IPR003657WRKY domain
PROSITE profilePS5081116.937221279IPR003657WRKY domain
PfamPF031064.3E-17222277IPR003657WRKY domain
Gene3DG3DSA:2.20.25.802.3E-31379454IPR003657WRKY domain
PROSITE profilePS5081131.582389454IPR003657WRKY domain
SuperFamilySSF1182904.18E-27390454IPR003657WRKY domain
SMARTSM007742.7E-35394453IPR003657WRKY domain
PfamPF031061.5E-23396451IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 534 aa     Download sequence    Send to blast
MAEHESFDAL QVEKLKPNEQ EEEEDEEGDE DEDEDEEGKR LGEIQLGELQ NSAPESRETQ  60
LETLAVPSTL ESSENDQCAG FQVNSTSQSI DGAQLQEQLG VSHQEILAIV THQDAQMQTQ  120
SPVQLAVYPT PLSELSPTSV TQSIQTQTQS PLQLTVYPTP LSELSPTSVT QSISSAPSPI  180
LLEQKLPPEK VNTLCTPEVD KQNSSDHKFI SSVPLVKTSA SDGYNWRKYG QKQVKSPQGS  240
RSYYRCTYSE CYAKKIECCD HSGYVTEIVY KSQHTHEPPR KSNCTKESKL ALSAECVRNS  300
VTEHPCRTVN DSEPSTSSKE RIQETPSIPE RKRQSPSDSD GNGDVKIKEE HGDGDEPEPK  360
RRVKKSNLEY STSLLKPGKK PKFVVHAAGD VGISGDGYRW RKYGQKMVKG NPHPRNYYRC  420
TSAGCPVRKH IETAIDNTSA VIITYKGIHD HDMPVPKKRH GPPSAPLVAA AAPASMNNLH  480
IKKTDTHQNQ ISSTQWSVDT GGELTGEALD LGGEKAMESA RTLLSIGFEI KPC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ayd_A2e-25382454274WRKY transcription factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element. {ECO:0000250|UniProtKB:Q9SI37}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.7G262600.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007204099.10.0probable WRKY transcription factor 32
SwissprotP595831e-132WRK32_ARATH; Probable WRKY transcription factor 32
TrEMBLM5W7R30.0M5W7R3_PRUPE; Uncharacterized protein
STRINGEMJ052980.0(Prunus persica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF51983456
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G30935.11e-124WRKY DNA-binding protein 32