PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.7G259300.1.p
Common NamePRUPE_ppa018934mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family ARR-B
Protein Properties Length: 696aa    MW: 76316.6 Da    PI: 5.6094
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.7G259300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like88.37.4e-28211264155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         kpr++W++eLH +Fv av+qL G e+A+Pk+il+lm+v+gLt+e+v+SHLQkYRl
  Prupe.7G259300.1.p 211 KPRVVWSKELHGKFVAAVHQL-GLERAVPKKILDLMNVQGLTRENVASHLQKYRL 264
                         79*******************.********************************7 PP

2Response_reg84.62.9e-28261341109
                         EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHH CS
        Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalea 89 
                         vl vdD+p+ ++ll+ +l++ +y +v++++++ eal +l+e++  +Dl+++D++mp+mdG++ll+ +  e  +lp+i++++h+++e++ + 
  Prupe.7G259300.1.p  26 VLAVDDNPICLRLLEGLLQNCQY-QVTTTTQAVEALLMLRESRnrFDLVITDVSMPDMDGFKLLELLGLEM-DLPVIMLSGHSDKELVMKG 114
                         799********************.9**************999889*********************96644.8****************** PP

                         HHTTESEEEESS--HHHHHH CS
        Response_reg  90 lkaGakdflsKpfdpeelvk 109
                         ++ Ga d+l Kp+ +eel++
  Prupe.7G259300.1.p 115 ISHGACDYLLKPVRKEELTN 134
                         *****************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363923.1E-1581695IPR017053Response regulator B-type, plant
SuperFamilySSF521722.13E-3623146IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23006.5E-4323164No hitNo description
SMARTSM004483.1E-3324136IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011044.66825140IPR001789Signal transduction response regulator, receiver domain
PfamPF000723.4E-2526134IPR001789Signal transduction response regulator, receiver domain
CDDcd001561.70E-2927140No hitNo description
SuperFamilySSF466894.3E-19208268IPR009057Homeodomain-like
PROSITE profilePS5129411.3208267IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.2E-29209268IPR009057Homeodomain-like
TIGRFAMsTIGR015577.2E-24211264IPR006447Myb domain, plants
PfamPF002491.9E-7213263IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 696 aa     Download sequence    Send to blast
MTVKAQRGGL IGEDGAMDRF PVGMRVLAVD DNPICLRLLE GLLQNCQYQV TTTTQAVEAL  60
LMLRESRNRF DLVITDVSMP DMDGFKLLEL LGLEMDLPVI MLSGHSDKEL VMKGISHGAC  120
DYLLKPVRKE ELTNIWQHVI RRKKFDSKDQ NKSSSQDKAC HETEGGQGVS PAGSSDQNGK  180
FNRKRKDQNE DEEEEYEDDE HENEDPSTQK KPRVVWSKEL HGKFVAAVHQ LGLERAVPKK  240
ILDLMNVQGL TRENVASHLQ KYRLCLKRLS STATQQASMV AAFGGKDSSY IRMGALDGFG  300
DLRSLAGSRR LSNATLSPYA PGGMLGRLNS PAGLSIRGIT SSGLVQPGHS QNLSNSISNL  360
VKLQPALPAN QSPNLYESIP TSLELNQLQQ GKHTAHIGES SPNNDPTSYS VPSSFPDTSV  420
SVSSIHSDSI TSSNPLILHR NPQQAFGMGV FGNRSSLSLA SLNPESFDIG ISSNFLDDNR  480
CSESWQVAVQ LSKFPSNDLP MSEPFDHGQL HANNLGLSST RPQIGNSPND FSSLSVLPGP  540
AEELRGNVWN QEGLIGDVVP TMDCTPKQRW EEHKRDYKHN LNLTFSATNP TVSANVIVSP  600
LSQSLDQSDA VCSKKMNSSL FDQLNGATPT VMQLSEVEKS AMGTKMKPSE DYLWEQTKSH  660
DGLVQNSYES LNDIMGAIMK GGQNENMLMD GEFWI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A1e-25207270164ARR10-B
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.7G259300.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007204866.20.0two-component response regulator ARR12
TrEMBLA0A251NH410.0A0A251NH41_PRUPE; Two-component response regulator
STRINGEMJ060650.0(Prunus persica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF95634112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.11e-100response regulator 12