PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.7G212300.1.p
Common NamePRUPE_ppa008425mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family MYB_related
Protein Properties Length: 333aa    MW: 36175.7 Da    PI: 9.8759
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.7G212300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding40.85e-13122166347
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         +WT+eE+  ++ + ++lG+g+W+ I+r   ++Rt+ q+ s+ qky
  Prupe.7G212300.1.p 122 PWTEEEHRTFLIGLEKLGKGDWRGISRNYVTTRTPTQVASHAQKY 166
                         8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501588.598320IPR001878Zinc finger, CCHC-type
PROSITE profilePS5129419.284115171IPR017930Myb domain
SuperFamilySSF466891.87E-17116171IPR009057Homeodomain-like
TIGRFAMsTIGR015574.0E-18118170IPR006447Myb domain, plants
SMARTSM007172.8E-9119169IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.4E-11119165IPR009057Homeodomain-like
CDDcd001671.60E-8122167No hitNo description
PfamPF002491.2E-10122166IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 333 aa     Download sequence    Send to blast
MGRKCSHCGN IGHNSRTCTN FRGTGTSFSV GHVGVRLFGV QLHHHDHHHL MMPSSSNMNH  60
HVAMSMKKSF SMDCLPTSSA SSSSPSSSRI SVDENSIQDK ASIGYLSDGL ICRAQERKKG  120
VPWTEEEHRT FLIGLEKLGK GDWRGISRNY VTTRTPTQVA SHAQKYFLRQ ATLTKKKRRS  180
SLFDMFGRSN NINLSTGHPA NTNTSHYKQP LSDDHQVLPP QHNNIIHDNS GATLPLLELG  240
TSVAAQNPNL DNLKPDHCSA NQQLPVWIYG LIDSQMKYSS NIAASKPGSS ASVVPDLELK  300
LAAPASPSLE QKNKSSPSPA GPLLNLGPIS VT*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1174178KKKRR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00565DAPTransfer from AT5G56840Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007202213.10.0hypothetical protein PRUPE_ppa008425mg
TrEMBLM5VQ380.0M5VQ38_PRUPE; Uncharacterized protein
STRINGVIT_11s0016g02410.t013e-85(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF32133271
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56840.12e-59MYB_related family protein