PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.7G209000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family LBD
Protein Properties Length: 191aa    MW: 21557.4 Da    PI: 6.2406
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.7G209000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260107.51e-33131121100
              DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91 
                         aCa+Ck +rrkC + C +apyf a++ ++f+n+hk+FG+sn++k+++ + +++r++a++s++ e++ar +dP +G++g+i+ l+ q++ l+
  Prupe.7G209000.1.p  13 ACASCKQQRRKCDETCEMAPYFLASRYSEFQNAHKIFGVSNIQKIMAMAAPDQRQAAAESILTEGNARKNDPLNGCLGIIRGLNAQIQGLE 103
                         7****************************************************************************************** PP

              DUF260  92 aelallkee 100
                          el+ +k++
  Prupe.7G209000.1.p 104 RELHIMKQH 112
                         ****99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.240.101.7E-4927IPR001138Zn(2)-C6 fungal-type DNA-binding domain
PROSITE profilePS5089122.69612113IPR004883Lateral organ boundaries, LOB
PfamPF031951.1E-3113110IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 191 aa     Download sequence    Send to blast
MENRDQGAAQ NHACASCKQQ RRKCDETCEM APYFLASRYS EFQNAHKIFG VSNIQKIMAM  60
AAPDQRQAAA ESILTEGNAR KNDPLNGCLG IIRGLNAQIQ GLERELHIMK QHLELCKEKE  120
ELDGKKNQSK EEDLQHDQSD GLNSLILPDL RLGRYLEHCS KPVTGLLCAL DVRSDEFKFD  180
SPEYFFKNQV *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007203460.11e-107hypothetical protein PRUPE_ppa022991mg, partial
TrEMBLM5VTJ21e-107M5VTJ2_PRUPE; Uncharacterized protein (Fragment)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF144321117
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13850.12e-28LOB domain-containing protein 22