PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.7G183300.3.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family WOX
Protein Properties Length: 243aa    MW: 27578.9 Da    PI: 6.2491
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.7G183300.3.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox69.54.1e-2260120257
                         T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
            Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                         r+R+t+t+ ql++Le+lFe+ n +ps+++++e++++l    +++e++V++WFqNrRa+ k+
  Prupe.7G183300.3.p  60 RQRWTPTPVQLQILERLFEQgNGTPSKQKIKEITSELsqhgQISETNVYNWFQNRRARSKR 120
                         89*****************99**************************************97 PP

2Wus_type_Homeobox101.94.4e-3359122265
   Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                         ar+RWtPtp Q++iLe+l+++G  tP+k++i++it+eL+++G+i+++NV++WFQNr+aR+++kq
  Prupe.7G183300.3.p  59 ARQRWTPTPVQLQILERLFEQGNGTPSKQKIKEITSELSQHGQISETNVYNWFQNRRARSKRKQ 122
                         789***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.6E-1855125IPR009057Homeodomain-like
PROSITE profilePS5007115.3756121IPR001356Homeobox domain
SMARTSM003895.8E-1558125IPR001356Homeobox domain
SuperFamilySSF466892.48E-1959125IPR009057Homeodomain-like
CDDcd000862.14E-1460122No hitNo description
PfamPF000466.6E-2060120IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 243 aa     Download sequence    Send to blast
MPVNLSLELE AIVFFLLSSI ISGFLLHDYG CLFVSRPGVR MGNLYCDPLM TSAGHKITAR  60
QRWTPTPVQL QILERLFEQG NGTPSKQKIK EITSELSQHG QISETNVYNW FQNRRARSKR  120
KQQNAACNHA ESEVETEVDS PKDKKTRPEE LFQSQQNSAQ RTEDLCFQSP EISSDLHFLD  180
PQTTKTDKMF PSNSGLRTSR HLSEMSFYDE VLSNSRNDLM TGKIEAGNYN LFQQAEDYGM  240
TG*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1113121RRARSKRKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00617PBMTransfer from AT4G35550Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008241933.11e-154PREDICTED: WUSCHEL-related homeobox 13
SwissprotO817881e-67WOX13_ARATH; WUSCHEL-related homeobox 13
TrEMBLA0A072VS224e-99A0A072VS22_MEDTR; Uncharacterized protein
STRINGVIT_04s0044g00150.t011e-96(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35550.18e-69WUSCHEL related homeobox 13