PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.7G183300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family WOX
Protein Properties Length: 272aa    MW: 31031.6 Da    PI: 5.6625
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.7G183300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox69.25e-2289149257
                         T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
            Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                         r+R+t+t+ ql++Le+lFe+ n +ps+++++e++++l    +++e++V++WFqNrRa+ k+
  Prupe.7G183300.1.p  89 RQRWTPTPVQLQILERLFEQgNGTPSKQKIKEITSELsqhgQISETNVYNWFQNRRARSKR 149
                         89*****************99**************************************97 PP

2Wus_type_Homeobox101.65.4e-3388151265
   Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                         ar+RWtPtp Q++iLe+l+++G  tP+k++i++it+eL+++G+i+++NV++WFQNr+aR+++kq
  Prupe.7G183300.1.p  88 ARQRWTPTPVQLQILERLFEQGNGTPSKQKIKEITSELSQHGQISETNVYNWFQNRRARSKRKQ 151
                         789***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.7E-1884154IPR009057Homeodomain-like
PROSITE profilePS5007115.3785150IPR001356Homeobox domain
SMARTSM003895.8E-1587154IPR001356Homeobox domain
SuperFamilySSF466893.08E-1988154IPR009057Homeodomain-like
PfamPF000468.0E-2089149IPR001356Homeobox domain
CDDcd000861.83E-1389151No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 272 aa     Download sequence    Send to blast
MMEWEKLQQK EHEMDGQANG NGGVLYVKVM TDEQLETLRK QIAVYASICE QLVEMHKNLT  60
AQQDLAGVRM GNLYCDPLMT SAGHKITARQ RWTPTPVQLQ ILERLFEQGN GTPSKQKIKE  120
ITSELSQHGQ ISETNVYNWF QNRRARSKRK QQNAACNHAE SEVETEVDSP KDKKTRPEEL  180
FQSQQNSAQR TEDLCFQSPE ISSDLHFLDP QTTKTDKMFP SNSGLRTSRH LSEMSFYDEV  240
LSNSRNDLMT GKIEAGNYNL FQQAEDYGMT G*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1142150RRARSKRKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00617PBMTransfer from AT4G35550Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008241933.10.0PREDICTED: WUSCHEL-related homeobox 13
SwissprotO817882e-96WOX13_ARATH; WUSCHEL-related homeobox 13
TrEMBLM5VTE51e-135M5VTE5_PRUPE; Uncharacterized protein (Fragment)
TrEMBLA0A072VS221e-133A0A072VS22_MEDTR; Uncharacterized protein
STRINGVIT_04s0044g00150.t011e-123(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18553493
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35550.19e-98WUSCHEL related homeobox 13