PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.7G164500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family GATA
Protein Properties Length: 402aa    MW: 43570.6 Da    PI: 6.2506
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.7G164500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA59.16e-19316350135
                GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                         Cs+Cg+ kTp+WR gp+g ktLCnaCG++y++ +l
  Prupe.7G164500.1.p 316 CSHCGVQKTPQWRTGPNGAKTLCNACGVRYKSGRL 350
                         *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011412.426310346IPR000679Zinc finger, GATA-type
SMARTSM004012.8E-17310364IPR000679Zinc finger, GATA-type
SuperFamilySSF577163.04E-14311372No hitNo description
Gene3DG3DSA:3.30.50.103.9E-15314348IPR013088Zinc finger, NHR/GATA-type
CDDcd002026.84E-15315363No hitNo description
PROSITE patternPS003440316341IPR000679Zinc finger, GATA-type
PfamPF003206.4E-17316350IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 402 aa     Download sequence    Send to blast
MLYQTHHSFL FQFHPFTCSI PSSSSTTSTS NSTSTSLLSS LSPHPPLPLT CPPPLPPQQV  60
ETEMECVEAA LKTSIRKEMA VKASSQAVFD DLLWGGVNGQ NGVACDDFSV DDLLDFSNED  120
GFVETEAEED DKDKVKGFAS VPPQKQPQDP ENSDLSEKNE LGPEPTSELS VPADDLENLE  180
WLSHFVEDSF TEFTTSLPAG FIPEKPKTEK RPDPAAPLPE KPCFKTPVPA KARSKRTRTG  240
GRVWSLGSPS LTETSSSSSS SSSSSSPSSP WLIYPTTQNR EPAEAGGEPV GSVEKPPKKP  300
KRRLVDGSSS QPPRRCSHCG VQKTPQWRTG PNGAKTLCNA CGVRYKSGRL LPEYRPACSP  360
TFSSELHSNH HRKVLEMRKK KDVTGVPEPG LTRPPVVPSF G*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1296302PKKPKRR
2296303PKKPKRRL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007204696.10.0hypothetical protein PRUPE_ppa008278mg
RefseqXP_008241780.10.0PREDICTED: GATA transcription factor 5-like
SwissprotQ9FH577e-92GATA5_ARATH; GATA transcription factor 5
TrEMBLM5WGI30.0M5WGI3_PRUPE; Uncharacterized protein
STRINGVIT_04s0023g02880.t011e-109(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF110834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66320.23e-86GATA transcription factor 5