PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.7G153700.1.p
Common NamePRUPE_ppa003124mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family GRAS
Protein Properties Length: 602aa    MW: 65807.8 Da    PI: 5.081
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.7G153700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS3672.6e-1122316012374
                GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilk 92 
                          ++Ll+cA+ ++++d  +a + L rl+e +s +gdp++R+ +yfteAL++r+++   +  k+l++++t ++  ++ + ++k++++++P+ k
  Prupe.7G153700.1.p 231 LKALLDCAR-LAESDPDRAVKSLIRLRESVSDRGDPTERVGFYFTEALQSRVSS--LQSEKSLAATTTYDTACEDFTLSYKALNDACPYSK 318
                         689******.566699999***********************************..6666778888888888******************* PP

                GRAS  93 fshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegpp.slRiTgvgspesg..skeeleetgerLakfAeelgvpfefnv 180
                         f+hltaNqaIlea+e+++++Hi+Df+i qG+QW+aLlqaLa+R+ g+p ++Ri g+ +p+ g   + +l +tg+rL++fA+ l+++fef++
  Prupe.7G153700.1.p 319 FAHLTANQAILEATERATKIHIVDFGIVQGVQWAALLQALATRSTGKPsRIRISGIPAPSLGtsPAASLFATGNRLRDFAKLLELNFEFEP 409
                         ********************************************666659*********99999999************************ PP

                GRAS 181 lvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsl 271
                          + + +++l+ + +rv+p+EalaVnl+lql++llde+ +  +   + Lkl ksl+Pk+v++ e ea++++  F  rf +al+yy+alf+sl
  Prupe.7G153700.1.p 410 -ILTPVHELDESCFRVEPDEALAVNLMLQLYNLLDETPTAVQ---SALKLAKSLNPKIVTLGEYEANLSRVGFTSRFKNALKYYTALFESL 496
                         .799******************************99999998...9********************************************* PP

                GRAS 272 eaklpreseerikvErellgreivnvvacegae.rrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslv.l 360
                         e ++ r+s er kvE+ llgr+i  vv  e+   +rer e +e+W+  +e++GF+pv+ls++a++qak ll ++++  y++ e+   ++ l
  Prupe.7G153700.1.p 497 EPNMTRDSPERLKVEKLLLGRRIGGVVGPEQPGtKRERFEDKEQWKYLMESSGFEPVALSHYAVSQAKILLWNYNNSLYSLIESPPGFLsL 587
                         *****************************998769****************************************999999888666666* PP

                GRAS 361 gWkdrpLvsvSaWr 374
                          W++ pL++vS+Wr
  Prupe.7G153700.1.p 588 AWNEVPLFTVSSWR 601
                         *************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098561.03204580IPR005202Transcription factor GRAS
PfamPF035148.9E-110231601IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 602 aa     Download sequence    Send to blast
MAYMCADSGN LMAIAQQVIK QKQQQEQQQQ QHHHHQQQPV GAFSLTPWPN NTHSPNLGYG  60
LTGSGYTDPF QLSGSSDAGG EPGFPFPNLD HHPTGFRFSD LGGGGAAEFD SDEWMDSIIG  120
GGDSTDSSNL PSACDTWHGS NADFGLYGAD PFQPPCPSRL SNPCSPPSDL NRVIFSETQN  180
QLPAWTAPPP PPPAPHVVVK QAKSADPPPQ PNEAVGVSSR SPEIESAPPL LKALLDCARL  240
AESDPDRAVK SLIRLRESVS DRGDPTERVG FYFTEALQSR VSSLQSEKSL AATTTYDTAC  300
EDFTLSYKAL NDACPYSKFA HLTANQAILE ATERATKIHI VDFGIVQGVQ WAALLQALAT  360
RSTGKPSRIR ISGIPAPSLG TSPAASLFAT GNRLRDFAKL LELNFEFEPI LTPVHELDES  420
CFRVEPDEAL AVNLMLQLYN LLDETPTAVQ SALKLAKSLN PKIVTLGEYE ANLSRVGFTS  480
RFKNALKYYT ALFESLEPNM TRDSPERLKV EKLLLGRRIG GVVGPEQPGT KRERFEDKEQ  540
WKYLMESSGF EPVALSHYAV SQAKILLWNY NNSLYSLIES PPGFLSLAWN EVPLFTVSSW  600
R*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-1542296013375GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppe.160720.0fruit
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007204097.10.0hypothetical protein PRUPE_ppa003124mg
SwissprotQ9FL030.0SCL4_ARATH; Scarecrow-like protein 4
TrEMBLM5VW270.0M5VW27_PRUPE; Uncharacterized protein
STRINGPOPTR_0005s12520.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF62803449
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66770.10.0GRAS family protein