PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.7G145700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family LBD
Protein Properties Length: 217aa    MW: 24471.5 Da    PI: 5.3889
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.7G145700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260115.14.5e-36131121100
              DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91 
                         aCa+Ck++rrkC + C +apyfpa++ ++f+n++k+FG+sn++k+++ + +++r++a++s++ e++ar +dPv+G++g+i+ l+ q++ l+
  Prupe.7G145700.1.p  13 ACASCKHQRRKCDETCEMAPYFPASRYSEFQNAQKIFGVSNIQKIMAMAAPDQRQAAAESILTEGNARKNDPVHGCLGIIRGLNAQIQGLE 103
                         7****************************************************************************************** PP

              DUF260  92 aelallkee 100
                          el+ +k++
  Prupe.7G145700.1.p 104 RELHIMKQH 112
                         ****99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.67812113IPR004883Lateral organ boundaries, LOB
PfamPF031951.1E-3313110IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 217 aa     Download sequence    Send to blast
MENRDQVAAQ NYACASCKHQ RRKCDETCEM APYFPASRYS EFQNAQKIFG VSNIQKIMAM  60
AAPDQRQAAA ESILTEGNAR KNDPVHGCLG IIRGLNAQIQ GLERELHIMK QHLELCKEKE  120
ELDGKKNQSK EEDLQHDQSD GLNFPSPILP DLPSHVTAEM RKYEQGYNYW SILEDAEEEV  180
FDIRLIEPVL FESNLKGNAS SSGSGKSRLC KTLYFV*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008241869.11e-140PREDICTED: LOB domain-containing protein 22-like
TrEMBLM5VSQ01e-111M5VSQ0_PRUPE; Uncharacterized protein (Fragment)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF144321117
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13850.12e-28LOB domain-containing protein 22