PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.7G138100.1.p
Common NamePRUPE_ppa006879mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family G2-like
Protein Properties Length: 393aa    MW: 43845.1 Da    PI: 6.4198
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.7G138100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.74.6e-32251306156
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                         k+r++W+peLH+rFve ++qLGG+++AtPk+i+elm+v+gLt+++vkSHLQkYRl+
  Prupe.7G138100.1.p 251 KQRRCWSPELHRRFVESLQQLGGTQVATPKQIRELMQVDGLTNDEVKSHLQKYRLH 306
                         79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.816248308IPR017930Myb domain
SuperFamilySSF466899.22E-18249309IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.8E-28250309IPR009057Homeodomain-like
TIGRFAMsTIGR015573.7E-26251306IPR006447Myb domain, plants
PfamPF002494.1E-7253304IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010092Biological Processspecification of organ identity
GO:0010629Biological Processnegative regulation of gene expression
GO:0048449Biological Processfloral organ formation
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 393 aa     Download sequence    Send to blast
MELSLDTSLV FIPKTISDFL AQLSTMEDSS QRSSELDAYV KRLEDEMRKI EVFKRELPLC  60
MLLLKDAIER LKEKVMQCKK MEDRPVIEEF IPLKGNLDEN GGGVLGKENS DKKNWMSSAQ  120
LWSTSLNIFE YNKHDSVSGL RMRNEEDDRS VPENPIEASN NRAMGRTFVP FKEQYESGFT  180
GTCLKDDKEV SQVPSLSLMT PLMSEALDAS TNTNIKSNNN CRGGSGSGLA GQLKLQNKPQ  240
QQSQQQQPFR KQRRCWSPEL HRRFVESLQQ LGGTQVATPK QIRELMQVDG LTNDEVKSHL  300
QKYRLHVRKL PASSAAKGNG IWMPLDHSAD HSKANNSQSG SPQGPLLPGE FAKGRSTTGG  360
ESDNSREAEE DEKSDGQSWK GGLLHNNQGG DV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A6e-14251304154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B6e-14251304154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C6e-14251304154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D6e-14251304154Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppe.11010.0fruit
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00629PBMTransfer from PK14402.1Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.7G138100.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007204391.10.0myb family transcription factor EFM isoform X1
TrEMBLM5WFN30.0M5WFN3_PRUPE; Uncharacterized protein
STRINGEMJ055900.0(Prunus persica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF120834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37180.14e-57G2-like family protein