PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.7G100200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family TCP
Protein Properties Length: 464aa    MW: 50542.6 Da    PI: 7.4115
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.7G100200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP577.9e-183698365
                 TCP  3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgt 65
                         k++r  + h+ v+gR RRvR++++c   +F L++eLG+ +d+ ti+WLl q  p+    +++
  Prupe.7G100200.1.p 36 LKRRRYIDKHSTVNGRHRRVRIPVTCCPGIFRLTQELGHRSDGDTIQWLLSQVRPELVLPPQS 98
                        6899999*********************************************99987766665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5136912.6464195IPR017887Transcription factor TCP subgroup
PfamPF036341.1E-134392IPR005333Transcription factor, TCP
SuperFamilySSF563176.54E-61137420IPR003010Carbon-nitrogen hydrolase
Gene3DG3DSA:3.60.110.106.7E-64137419IPR003010Carbon-nitrogen hydrolase
PROSITE profilePS5026338.172138442IPR003010Carbon-nitrogen hydrolase
CDDcd075648.76E-109138452No hitNo description
PfamPF007952.5E-54139416IPR003010Carbon-nitrogen hydrolase
PROSITE patternPS009200170185IPR000132Nitrilase/cyanide hydratase, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006807Biological Processnitrogen compound metabolic process
GO:0016810Molecular Functionhydrolase activity, acting on carbon-nitrogen (but not peptide) bonds
Sequence ? help Back to Top
Protein Sequence    Length: 464 aa     Download sequence    Send to blast
MEINQTLPSK TLAITDPPEN PSLQTQPPQQ QEQQQLKRRR YIDKHSTVNG RHRRVRIPVT  60
CCPGIFRLTQ ELGHRSDGDT IQWLLSQVRP ELVLPPQSNN RTRRLPPDPV PQPNCRYPGA  120
AEDGLDHKAV ARLPSVTVRA TVVQASTVFF DTPATLDKAE RLVAGAAAYG SQLVVFPEAF  180
VGGYPRGLMF DSATATLSAE EKQAFEKYYA SAIDVPGPEV DRLAKIASKY KVHLVMGVVE  240
RVGFYLCSTV LFFDSFGQCL GKHPKLRPLA SESPVWCSGA KLPLSVYDTE IGRIGGIVCW  300
DNRMPDLRTQ LYAKGIEIYC APTAEAREIW RSSMTHIALE GGCFVLSANQ FCRRKDYPLP  360
LECVSGDSND ATSLDIICAG GSVIVSPSGT ILAGPNYQGE SLISADLDLV EIARAKLEFG  420
GVGLGHNAGP NAVGWRRTSI PNPDLFAATV KTEVSDHANV LYA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3wuy_A5e-3413743115302Nitrilase
3wuy_B5e-3413743115302Nitrilase
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots, stems, cotyledons, leaves and flowers. {ECO:0000269|PubMed:10574458}.
Functional Description ? help Back to Top
Source Description
UniProtHighly specific for beta-cyano-L-alanine (Ala(CN)). Low activity with 3-phenylpropionitrile (PPN). Not associated with auxin production but may be involved in cyanide detoxification. {ECO:0000269|PubMed:10574458, ECO:0000269|PubMed:11060302}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.7G100200.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Not induced by abscisic acid or by 1-aminocyclopropane-1-carboxylic acid (ACC). {ECO:0000269|PubMed:10574458}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020423733.10.0bifunctional nitrilase/nitrile hydratase NIT4B isoform X1
SwissprotQ429661e-139NRL4B_TOBAC; Bifunctional nitrilase/nitrile hydratase NIT4B
TrEMBLA0A251N9I70.0A0A251N9I7_PRUPE; Uncharacterized protein
STRINGXP_008243489.10.0(Prunus mume)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF458388
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45680.11e-16TCP family protein
Publications ? help Back to Top
  1. Dohmoto M,Sano J,Tsunoda H,Yamaguchi K
    Structural analysis of the TNIT4 genes encoding nitrilase-like protein from tobacco.
    DNA Res., 1999. 6(5): p. 313-7
    [PMID:10574458]
  2. Piotrowski M,Schönfelder S,Weiler EW
    The Arabidopsis thaliana isogene NIT4 and its orthologs in tobacco encode beta-cyano-L-alanine hydratase/nitrilase.
    J. Biol. Chem., 2001. 276(4): p. 2616-21
    [PMID:11060302]