PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.7G075300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family G2-like
Protein Properties Length: 434aa    MW: 48693.2 Da    PI: 7.0487
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.7G075300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like96.81.5e-30246300155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         k+r+rW+++LHe+Fve+v++LGG++kAtPk+il++m ++gLt+ hvkSHLQkYR+
  Prupe.7G075300.1.p 246 KTRIRWNQDLHEKFVECVNRLGGADKATPKAILKMMCLDGLTIFHVKSHLQKYRI 300
                         68****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.33E-16244300IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.6E-27244301IPR009057Homeodomain-like
TIGRFAMsTIGR015574.7E-22246301IPR006447Myb domain, plants
PfamPF002499.6E-8250299IPR001005SANT/Myb domain
PfamPF143792.2E-20343389IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 434 aa     Download sequence    Send to blast
MNAQKIDCQE RIIQQSHGLI SDFNFELGSQ SSQIFDLQQQ AWNMGIWVQQ PTEDQPNMSQ  60
LQSHGLPRSP SSIMSRFESP ASAFYATERC MGFSQYHSQV GNLQFPSGQT YNESYSSMDS  120
SEQADPNLDI RNTLQSIVKS QPSSYHQYQK SSEKPNQIPL PSNNLFEHQQ NKLQGESTAS  180
VRRPSLSLPP KENQDQAGGC NSFSTSPVTQ LSFFPQQGKQ SPRISSGNVS TTYGDSPSTS  240
PVLSSKTRIR WNQDLHEKFV ECVNRLGGAD KATPKAILKM MCLDGLTIFH VKSHLQKYRI  300
AKYLPDTAEG KSEKRTTLNV EPQLDMKTLL QPNNVNFSGS GLQIKEALQL QLDVQRRLHE  360
QLEIQRNLQL RIEEQGKQLK KMFDLQQKTS NDLFKTQNLD ITCHEDAPSD SLNAIQVSSP  420
EDSGNSNFPS KIS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A3e-22246303259Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B3e-22246303259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A3e-22246303259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C3e-22246303259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D3e-22246303259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F3e-22246303259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H3e-22246303259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J3e-22246303259Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.7G075300.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020423309.10.0myb family transcription factor PHL5 isoform X1
SwissprotQ0WVU34e-70PHL5_ARATH; Myb family transcription factor PHL5
TrEMBLA0A251N8480.0A0A251N848_PRUPE; Uncharacterized protein
STRINGXP_008240945.10.0(Prunus mume)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF37403465
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06800.12e-72G2-like family protein