PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.7G065000.1.p
Common NamePRUPE_ppa026190mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family NAC
Protein Properties Length: 429aa    MW: 49202.8 Da    PI: 6.3221
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.7G065000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM133.12e-41321591128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdk 90 
                         lp G+rF Ptd elv+ yL+ kv +k+++  + + ++di  ++P+dL  + +  +e+ewyfF++r++ky++g+r+ r++ +g+Wkatgk +
  Prupe.7G065000.1.p  32 LPCGYRFAPTDAELVSSYLEGKVLNKEIPK-NRFLDLDISLYHPRDLTgRITLIRESEWYFFTSRKRKYPKGQRPDRSAVDGFWKATGKAQ 121
                         699*************************99.67999***********9444445889********************99************ PP

                 NAM  91 evlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         ++ +++g+++g k+tL fy+g++++g++t+W mhey+l
  Prupe.7G065000.1.p 122 DIEDSNGKVIGSKRTLDFYQGNHQDGKRTEWKMHEYTL 159
                         ************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.09E-4528185IPR003441NAC domain
PROSITE profilePS5100545.68532185IPR003441NAC domain
PfamPF023659.6E-2233159IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 429 aa     Download sequence    Send to blast
MGENNRFIND PIPEQVDLFI NDPTNDAYFN SLPCGYRFAP TDAELVSSYL EGKVLNKEIP  60
KNRFLDLDIS LYHPRDLTGR ITLIRESEWY FFTSRKRKYP KGQRPDRSAV DGFWKATGKA  120
QDIEDSNGKV IGSKRTLDFY QGNHQDGKRT EWKMHEYTLD APPNEISNTR VTQLDNCVLC  180
KIYKNNKGGN NDSSTTQSDQ RAEPSTNVVA SQAFPDQQIQ PVHQHDQYLV SQSSGASSSS  240
TANKRPRGRP TPTILNTYVG NPTYYPHQQY PFQNQTSGNP PGPVHNNYQN LTQYNQNDQN  300
LTQYDQNDQN LTQYAQNDQN LTQYDQNDQN LTQYDTQSAN IESHVQPRES FSSQPGFLPH  360
METSTYADQM PLVDSSSMQL PVHVRLYEQL LAARNKDGDF DKRLEHWYHH QQQLFRQNPS  420
STPNCKLV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A8e-323118516165NO APICAL MERISTEM PROTEIN
1ut4_B8e-323118516165NO APICAL MERISTEM PROTEIN
1ut7_A8e-323118516165NO APICAL MERISTEM PROTEIN
1ut7_B8e-323118516165NO APICAL MERISTEM PROTEIN
3swm_A1e-313118519168NAC domain-containing protein 19
3swm_B1e-313118519168NAC domain-containing protein 19
3swm_C1e-313118519168NAC domain-containing protein 19
3swm_D1e-313118519168NAC domain-containing protein 19
3swp_A1e-313118519168NAC domain-containing protein 19
3swp_B1e-313118519168NAC domain-containing protein 19
3swp_C1e-313118519168NAC domain-containing protein 19
3swp_D1e-313118519168NAC domain-containing protein 19
4dul_A8e-323118516165NAC domain-containing protein 19
4dul_B8e-323118516165NAC domain-containing protein 19
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.7G065000.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFM2535640.0FM253564.1 Prunus cerasifera BAC insert containing Ma gene, ma1 susceptible allele, clone 40K9.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007202186.20.0NAC domain-containing protein 26
TrEMBLM5W9A70.0M5W9A7_PRUPE; Uncharacterized protein (Fragment)
STRINGEMJ033850.0(Prunus persica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15078714
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04070.26e-37NAC domain containing protein 47