PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.7G064900.1.p
Common NamePRUPE_ppa018568mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family NAC
Protein Properties Length: 327aa    MW: 37287.9 Da    PI: 6.078
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.7G064900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM139.81.7e-43261531128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.kkvkaeekewyfFskrdkkyatgkrknr.atksgyWkatgkd 89 
                         lp G+rF Pt+eelv eyLkkk++++ l++ + ++evd+yk++P++L  ++   +e+ewyfFs+r++ky++g+r+nr a ++gyWkatg+d
  Prupe.7G064900.1.p  26 LPSGYRFVPTNEELVEEYLKKKIKNELLPI-NRFREVDVYKYHPEELTgMHNLLRENEWYFFSSRERKYPNGSRPNRaADNHGYWKATGTD 115
                         699***************************.77**************8433334899********************66779********* PP

                 NAM  90 kevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                          ++++ ++e++g k++L fy g++ +g+kt+W mhey l
  Prupe.7G064900.1.p 116 DKIKV-NNEVIGQKRILDFYAGKHGEGVKTEWKMHEYVL 153
                         *****.999****************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.44E-5022181IPR003441NAC domain
PROSITE profilePS5100549.1626182IPR003441NAC domain
PfamPF023652.1E-2227153IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 327 aa     Download sequence    Send to blast
MEESNIQVSH EIFDEAWLTD KYINDLPSGY RFVPTNEELV EEYLKKKIKN ELLPINRFRE  60
VDVYKYHPEE LTGMHNLLRE NEWYFFSSRE RKYPNGSRPN RAADNHGYWK ATGTDDKIKV  120
NNEVIGQKRI LDFYAGKHGE GVKTEWKMHE YVLSGNIAPS NGHKANGDMK LNDCVLCKIY  180
KNKRVKKNKN KGIADSVQSA HQHDHQEYPS PLIANSNSSS SSINHHYTAA GMSSTTVNTE  240
FGEPPYYNES FQNGAWSNYP WPITSFNNHR TLDSAYTSHG LPMNTFSSPF STDLEPANDT  300
ALADPSTSSQ IPHDHAEEDD NNSFDI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-432618317166NO APICAL MERISTEM PROTEIN
1ut4_B1e-432618317166NO APICAL MERISTEM PROTEIN
1ut7_A1e-432618317166NO APICAL MERISTEM PROTEIN
1ut7_B1e-432618317166NO APICAL MERISTEM PROTEIN
3swm_A1e-432618320169NAC domain-containing protein 19
3swm_B1e-432618320169NAC domain-containing protein 19
3swm_C1e-432618320169NAC domain-containing protein 19
3swm_D1e-432618320169NAC domain-containing protein 19
3swp_A1e-432618320169NAC domain-containing protein 19
3swp_B1e-432618320169NAC domain-containing protein 19
3swp_C1e-432618320169NAC domain-containing protein 19
3swp_D1e-432618320169NAC domain-containing protein 19
4dul_A1e-432618317166NAC domain-containing protein 19
4dul_B1e-432618317166NAC domain-containing protein 19
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.7G064900.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFM2535630.0FM253563.1 Prunus cerasifera BAC insert containing Ma gene, resistant Ma1 allele, clone 76H19.
GenBankFM2535640.0FM253564.1 Prunus cerasifera BAC insert containing Ma gene, ma1 susceptible allele, clone 40K9.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007202204.20.0NAC transcription factor 29
TrEMBLA0A251N7L20.0A0A251N7L2_PRUPE; Uncharacterized protein
STRINGEMJ034030.0(Prunus persica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15078714
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08790.12e-43NAC family protein