PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.7G061900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family NAC
Protein Properties Length: 426aa    MW: 47682.2 Da    PI: 4.8441
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.7G061900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM121.57.8e-38461672128
                 NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                         ppG rF Ptdeel+v+yL++++ +++      i ++diy++ P +L + ++  e+  ++f+++r++ky++gkr++r+++ gyWkatgkd++
  Prupe.7G061900.1.p  46 PPGWRFCPTDEELIVFYLRNRTWNNS-----RIIHLDIYDFTPMQLAEYFEIpEDPVMFFYTTRKRKYKNGKRPSRTANIGYWKATGKDTP 131
                         9*******************998887.....35689**********976666345588********************************* PP

                 NAM  92 vlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         +++  +   g+kk+Lvfy g++++g+kt+W+mhey+l
  Prupe.7G061900.1.p 132 IKE-IDGSFGVKKSLVFYLGQQKEGKKTNWIMHEYTL 167
                         **9.6778***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.96E-4333182IPR003441NAC domain
PROSITE profilePS5100539.88845183IPR003441NAC domain
PfamPF023659.1E-2246167IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 426 aa     Download sequence    Send to blast
MASTGDPAAN KGKAPALYGD DDDDRHRDMV TKMMMMKEER VSMGIPPGWR FCPTDEELIV  60
FYLRNRTWNN SRIIHLDIYD FTPMQLAEYF EIPEDPVMFF YTTRKRKYKN GKRPSRTANI  120
GYWKATGKDT PIKEIDGSFG VKKSLVFYLG QQKEGKKTNW IMHEYTLQKE EFEACVLCKV  180
YETSRGKNSR KNSRNEANTV SNDVGEQGTN PSTTRSQAEE DQALRFLPLP PPLPNIYCGS  240
SSSSSSSNLA GQYDVHMTNH SAHALNNVSF PQCTWASNGL GAHPEVTTLA PMAHAQLENS  300
IPLLHSMNIY DQDGYLLNEN IEFYQSTAPY GFEVQSLPMY NNVSQPNNSG YGMAPTDTTE  360
EEEELYLLHE PLPDFSFPID DNAECVPFGM PVESAKPLNS VTPTDPVMQS TNPGGNSTTT  420
PIDGH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-304318215164NO APICAL MERISTEM PROTEIN
1ut4_B3e-304318215164NO APICAL MERISTEM PROTEIN
1ut7_A3e-304318215164NO APICAL MERISTEM PROTEIN
1ut7_B3e-304318215164NO APICAL MERISTEM PROTEIN
4dul_A3e-304318215164NAC domain-containing protein 19
4dul_B3e-304318215164NAC domain-containing protein 19
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.7G061900.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007202990.20.0NAC domain-containing protein 55
TrEMBLA0A251NAL80.0A0A251NAL8_PRUPE; Uncharacterized protein
STRINGXP_008245332.10.0(Prunus mume)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF2051144
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69490.11e-37NAC-like, activated by AP3/PI