PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.7G027500.1.p
Common NamePRUPE_ppa026577mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family G2-like
Protein Properties Length: 324aa    MW: 34711.7 Da    PI: 6.948
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.7G027500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like96.61.9e-30109162155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         +prl+Wtp+LH+rFv+av++L G+++A+Pkti++lm+v+gLt+e+v+SHLQkYRl
  Prupe.7G027500.1.p 109 RPRLVWTPQLHKRFVDAVAHL-GIKNAVPKTIMQLMSVDGLTRENVASHLQKYRL 162
                         59*******************.********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.23E-20106166IPR009057Homeodomain-like
PROSITE profilePS5129411.059106165IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.3E-30108167IPR009057Homeodomain-like
TIGRFAMsTIGR015573.6E-24110162IPR006447Myb domain, plants
PfamPF002491.3E-7112161IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    Send to blast
MREDESNWFS RWEEELPSPE ELMPLSQTLI TPDLALAFDI RNNNPNNPSS PQNQQPPQPP  60
QPPHTPPPPP PSSLPPATPT HPNSSAEFAD SADLGSGAGG EEPARTLKRP RLVWTPQLHK  120
RFVDAVAHLG IKNAVPKTIM QLMSVDGLTR ENVASHLQKY RLYLKRMQGL SGGGSGGGGG  180
GGGGLAASAD PATDHLFASS PVPAHFLHPH PGGRPNSEHF MPFVPVALQQ HHHQQQQQQQ  240
QMAAAAAAAV AAHPQYHRQV GHFGSPPNGQ FEHPFLARQS SQPVHRMGAP LHNPVPGSYV  300
EDLESANATG GRKVLTLFPT GED*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5lxu_A1e-31109165157Transcription factor LUX
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots, leaves, stems, petioles, filaments, stigma, pedicels, sepals, anthers, petals, and siliques. {ECO:0000269|PubMed:20331973}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that acts as a negative regulator of freezing tolerance via a CBF-independent pathway. {ECO:0000269|PubMed:20331973}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.7G027500.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by drought, salt and abscisic acid (ABA). Down-regulated by cold. {ECO:0000269|PubMed:20331973}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007203675.10.0transcription factor PCL1
SwissprotO222103e-64MYBC1_ARATH; Transcription factor MYBC1
TrEMBLM5VU330.0M5VU33_PRUPE; Uncharacterized protein
STRINGEMJ048740.0(Prunus persica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF85423045
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10760.11e-85G2-like family protein
Publications ? help Back to Top
  1. Sardesai N,Laluk K,Mengiste T,Gelvin S
    The Arabidopsis Myb transcription factor MTF1 is a unidirectional regulator of susceptibility to Agrobacterium.
    Plant Signal Behav, 2018.
    [PMID:24785741]