PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.7G023300.2.p
Common NamePRUPE_ppa009512mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family G2-like
Protein Properties Length: 290aa    MW: 31486.3 Da    PI: 8.4471
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.7G023300.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like105.62.8e-3346100155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         k+rlrWt++LH+rFv+a++qLGG+++AtPk +l++m+v+gLt++hvkSHLQkYRl
  Prupe.7G023300.2.p  46 KQRLRWTSDLHDRFVDAITQLGGPDRATPKGVLRVMGVPGLTIYHVKSHLQKYRL 100
                         79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.88443103IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.2E-3244101IPR009057Homeodomain-like
SuperFamilySSF466893.76E-1745100IPR009057Homeodomain-like
TIGRFAMsTIGR015574.7E-2646101IPR006447Myb domain, plants
PfamPF002491.5E-74899IPR001005SANT/Myb domain
PfamPF143791.6E-24132178IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 290 aa     Download sequence    Send to blast
MYHAKKFSTA SLVPHKPQSS EELANVGVVS GGSSVKSPTP SGGSGKQRLR WTSDLHDRFV  60
DAITQLGGPD RATPKGVLRV MGVPGLTIYH VKSHLQKYRL AKYLPESPAD GSKDEKKGSG  120
DSLSCSDSSP GVQINEALRM QMEVQKRLHE QLEVQRQLQM RIEAQGKYLQ KIIEEQEKLG  180
GVLKGSDALP SAEDKQKPSQ LETAGDASAT PSSPRKKQRV DDGLPDGCTT SNVPPKADQK  240
NEFVGQWDRD LYGSDGGFGF NLQREFKERD GDAAQKAPME LDPLCGSKQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-2345103159Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-2345103159Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-2345103159Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-2345103159Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-2345103159Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-2345103159Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-2345103159Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-2345103159Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.7G023300.2.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFR8285520.0FR828552.1 Rosa hybrid cultivar mRNA for putative MYB transcription factor (myb1 gene), cultivar Yellow Island.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007202402.10.0myb family transcription factor PHL7 isoform X1
RefseqXP_020424093.10.0myb family transcription factor PHL7 isoform X1
SwissprotQ9SJW02e-73PHL7_ARATH; Myb family transcription factor PHL7
TrEMBLM5VRH60.0M5VRH6_PRUPE; Uncharacterized protein
STRINGEMJ036010.0(Prunus persica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01060.12e-69G2-like family protein