PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.7G013900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family NAC
Protein Properties Length: 432aa    MW: 48224.9 Da    PI: 4.9675
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.7G013900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM68.22.3e-216218013128
                 NAM  13 elvveyLkkkvegkkleleevikevdiykvePwdLpk....kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk..kg 97 
                         +l +++Lk+ ++gk  +    i+e+d+yk+ePwdL +        + + w+ Fs+ d k+a++ r nrat +g+Wk tgk ++ +s+   +
  Prupe.7G013900.1.p  62 QLFCRFLKRMMQGKASQS---IPEIDVYKYEPWDLAElmfpDSPYQPRAWFSFSRPDYKSANSPRCNRATGKGFWKITGKPRQAKSRqlPK 149
                         68899********99666...**************8444553333778************************************9986656 PP

                 NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
                         +++  k+tL+f++gr +k+++t  v +ey l
  Prupe.7G013900.1.p 150 SVTCKKRTLTFHEGRVSKSRNTGCVRQEYYL 180
                         6677889*********************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100525.19615203IPR003441NAC domain
PfamPF023651.1E-1017179IPR003441NAC domain
SuperFamilySSF1019411.24E-2362203IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 432 aa     Download sequence    Send to blast
MSRSMSTTKE SVLDLLPKFR FHPSEEEMVN LLKNKVEGQD SQAIPDEIVD KPRDLPDNES  60
IQLFCRFLKR MMQGKASQSI PEIDVYKYEP WDLAELMFPD SPYQPRAWFS FSRPDYKSAN  120
SPRCNRATGK GFWKITGKPR QAKSRQLPKS VTCKKRTLTF HEGRVSKSRN TGCVRQEYYL  180
TPTDPGSNPN QLSGFVLSRM KNKSTDNESD NKKHQDVSVC VESADPGISG CMASNSELDQ  240
AAGIHLISDA EEHLTYKELE HVLLGSGNQN DGEPGGFVSS DFDDMIQELC AKGGEYLDLP  300
SPPPELPRQR QPPQLGNVPV TGDYIGSNSN NQAAAINHMI PDPEELLAYK ELERVLGSCN  360
PDDGEPGGCV SSNMLQKVYS QAEENLESFF RQFEPEDYIL PIVPRTGRFL HANNYIGCNE  420
LQSAALFPQS S*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-151020910174Stress-induced transcription factor NAC1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.7G013900.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020424196.10.0NAC domain-containing protein 68
TrEMBLA0A251N5200.0A0A251N520_PRUPE; Uncharacterized protein
STRINGEMJ048510.0(Prunus persica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF1714827
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10480.21e-25NAC domain containing protein 50