PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.7G003400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family GeBP
Protein Properties Length: 376aa    MW: 42236.9 Da    PI: 8.972
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.7G003400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573103.12.2e-32209301398
              DUF573   3 fqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelsk 93 
                          qr+ws++Dei++L G+id+ +k+g++p +d+ af++f+kks++++v+k+ql +KirrLKkK++++v+k   gk+ +  k+h+  +f+lsk
  Prupe.7G003400.1.p 209 LQRIWSDDDEITILEGMIDYYTKQGVHPNADMFAFHDFMKKSLKADVNKTQLQDKIRRLKKKYETDVSK---GKKYNPVKPHELWVFDLSK 296
                         69*******************************************************************...999999************* PP

              DUF573  94 kiWgs 98 
                         k+Wgs
  Prupe.7G003400.1.p 297 KVWGS 301
                         ***95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045042.2E-30210300IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 376 aa     Download sequence    Send to blast
ISPMAPNHTS PQDEPPEEVE ASSEEEVDRE EEEESESQPE SKSEEPEPKG APTPVDEKKP  60
QPKNPDLATV PQSSSPGSEK WKPRLKKKLT EKKRKNPDPS CTYYKKKPDS AMEETPKTKK  120
PRSNASATTT SAAKAGSKQP SSKNPIKKLA SATTTPAARA RSKRPSESDP KDSKRPKKKK  180
IPELDEEPDQ AREETKKAGG DDLKKLLLLQ RIWSDDDEIT ILEGMIDYYT KQGVHPNADM  240
FAFHDFMKKS LKADVNKTQL QDKIRRLKKK YETDVSKGKK YNPVKPHELW VFDLSKKVWG  300
SSEGLFALGG LSEQYKCNET CAGLRELTLL EGCLELIGEP KRAELKEEWK KLHVAELELV  360
IRRGELAKLI LEALK*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.7G003400.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020423813.10.0STOREKEEPER protein
TrEMBLA0A251N4A20.0A0A251N4A2_PRUPE; Uncharacterized protein (Fragment)
STRINGEMJ051450.0(Prunus persica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18313490
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00390.16e-24DNA-binding storekeeper protein-related transcriptional regulator