PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.7G001400.1.p
Common NamePRUPE_ppa005770mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family NAC
Protein Properties Length: 460aa    MW: 51029.4 Da    PI: 5.9741
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.7G001400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM180.25.2e-56181481129
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                         lppGfrFhPtdee+++ yL++kv ++++ +  +i e+d++k+ePwdLpkk+k +ekewyfF++rd+ky+tg r+nrat+sgyWkatgkdke
  Prupe.7G001400.1.p  18 LPPGFRFHPTDEEIITSYLTEKVIDSSFVA-IAIGEADLNKCEPWDLPKKAKMGEKEWYFFCQRDRKYPTGMRTNRATESGYWKATGKDKE 107
                         79*************************988.78***************99999************************************** PP

                 NAM  92 vlskkgel...vglkktLvfykgrapkgektdWvmheyrle 129
                         ++++kg++   vg+kktLvfy+grapkgekt+Wvmheyrle
  Prupe.7G001400.1.p 108 IFNNKGKAgclVGMKKTLVFYRGRAPKGEKTNWVMHEYRLE 148
                         ***85555666****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.93E-6314174IPR003441NAC domain
PROSITE profilePS5100559.98118173IPR003441NAC domain
PfamPF023653.4E-2919147IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 460 aa     Download sequence    Send to blast
MEQNMVVNRG AEDQLIELPP GFRFHPTDEE IITSYLTEKV IDSSFVAIAI GEADLNKCEP  60
WDLPKKAKMG EKEWYFFCQR DRKYPTGMRT NRATESGYWK ATGKDKEIFN NKGKAGCLVG  120
MKKTLVFYRG RAPKGEKTNW VMHEYRLEGK ISQYTNLSKA AKDEWVVCRV FHKNMGLKKI  180
NNTPTRMNSF GDHDLLDYSS LPPLMDPTSF NDNLMNNNDN KACGYGDHDV KPGANLASTA  240
PSLSSAKASS SDDHHAINNN NYLSYFSIGG SGGQVQKPNY SFQVQPTNSY YQATSLSNNP  300
NMLYPHHHQF QNPNPNPNPS SFWFQPNPNN SDYFQQGMIR VTNNTTSDHD EDDQAMLRAI  360
AAANNSNMNN ETSSSAAAGF GSSGGLARQC KVEQFSSAPE SMFSLSQDTG VSTDINTTEI  420
SSSLVSSKQE LGSAADNCSS YDQRPSVVPI SDIEGLWDF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-521617915171NO APICAL MERISTEM PROTEIN
1ut4_B3e-521617915171NO APICAL MERISTEM PROTEIN
1ut7_A3e-521617915171NO APICAL MERISTEM PROTEIN
1ut7_B3e-521617915171NO APICAL MERISTEM PROTEIN
4dul_A3e-521617915171NAC domain-containing protein 19
4dul_B3e-521617915171NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppe.161510.0fruit
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00518DAPTransfer from AT5G18270Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.7G001400.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF1981257e-82KF198125.1 Malus hupehensis NAC domain protein (NAC112) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020424734.10.0NAC domain-containing protein 100
TrEMBLA0A251N4940.0A0A251N494_PRUPE; Uncharacterized protein
STRINGXP_008240446.10.0(Prunus mume)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40934171
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18270.11e-110Arabidopsis NAC domain containing protein 87