PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.7G001200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family NAC
Protein Properties Length: 384aa    MW: 42910.4 Da    PI: 8.4188
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.7G001200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM175.21.8e-5491371128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                         lppGfrFhPtdeel+ +yL+kkv++++l++ ++i+evdiyk++Pw+Lp+k++ +ekewyfFs+rd+ky++g r+nra++sgyWkatg+dk+
  Prupe.7G001200.1.p   9 LPPGFRFHPTDEELILHYLTKKVASTPLPV-SIIAEVDIYKFDPWELPAKAAFGEKEWYFFSPRDRKYPNGARPNRAAASGYWKATGTDKT 98 
                         79****************************.89***************988899************************************* PP

                 NAM  92 vlsk..kgelvglkktLvfykgrapkgektdWvmheyrl 128
                         ++++  ++++vg+kk Lvfykgr pkg kt+W+mheyrl
  Prupe.7G001200.1.p  99 IVASlgGRQNVGVKKALVFYKGRPPKGIKTNWIMHEYRL 137
                         ***9988999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.92E-655171IPR003441NAC domain
PROSITE profilePS5100562.5559171IPR003441NAC domain
PfamPF023651.5E-2710137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 384 aa     Download sequence    Send to blast
MMKNPESSLP PGFRFHPTDE ELILHYLTKK VASTPLPVSI IAEVDIYKFD PWELPAKAAF  60
GEKEWYFFSP RDRKYPNGAR PNRAAASGYW KATGTDKTIV ASLGGRQNVG VKKALVFYKG  120
RPPKGIKTNW IMHEYRLPEN PNNYTTTTKT MKLKDLSMRL DDWVLCRIYK KSNVSSSAAV  180
PPIDHEEEVE EEEDFLHDVL LPSLKSPLPG LGHNMSTNNT GLKPQKSSSF SNLLDVMDYS  240
LLTSFLADGQ YSNPTGTGLQ STPNRFPCSG TTGLDQKPLF INDYSNISSS SSSNSHLLQK  300
LPQFNGLNLP GIPSTENRLK RHDHPIADDH GLLYPSKKYV NSNCSFNNAT IQSDNISQGH  360
LLNHSLLNHQ QLVLSSPQFQ FQE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-72817316167NO APICAL MERISTEM PROTEIN
1ut4_B1e-72817316167NO APICAL MERISTEM PROTEIN
1ut7_A1e-72817316167NO APICAL MERISTEM PROTEIN
1ut7_B1e-72817316167NO APICAL MERISTEM PROTEIN
3swm_A2e-72817319170NAC domain-containing protein 19
3swm_B2e-72817319170NAC domain-containing protein 19
3swm_C2e-72817319170NAC domain-containing protein 19
3swm_D2e-72817319170NAC domain-containing protein 19
3swp_A2e-72817319170NAC domain-containing protein 19
3swp_B2e-72817319170NAC domain-containing protein 19
3swp_C2e-72817319170NAC domain-containing protein 19
3swp_D2e-72817319170NAC domain-containing protein 19
4dul_A1e-72817316167NAC domain-containing protein 19
4dul_B1e-72817316167NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds to the promoter of ACO5, an ACC oxidase involved in ethylene biosynthesis. Mediates waterlogging-induced hyponastic leaf movement, and cell expansion in abaxial cells of the basal petiole region, by directly regulating the expression of ACO5 (PubMed:24363315). Required for normal seed development and morphology (PubMed:18849494). {ECO:0000269|PubMed:18849494, ECO:0000269|PubMed:24363315}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00333DAPTransfer from AT3G04070Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.7G001200.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By root flooding (PubMed:24363315). Induced by senescence (PubMed:24659488). {ECO:0000269|PubMed:24363315, ECO:0000269|PubMed:24659488}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKR8227100.0KR822710.1 Prunus persica NAC transcription factor NAC3 (NAC3) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020424848.10.0NAC transcription factor 29
SwissprotQ84TD67e-99NAC47_ARATH; NAC transcription factor 47
TrEMBLA0A0P0KKI10.0A0A0P0KKI1_PRUPE; NAC transcription factor NAC3
STRINGXP_008240449.10.0(Prunus mume)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF66212750
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04070.17e-93NAC domain containing protein 47
Publications ? help Back to Top
  1. Hofmann NR
    A NAC transcription factor for flooding: SHYG helps plants keep their leaves in the air.
    Plant Cell, 2013. 25(12): p. 4771
    [PMID:24363314]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Zhou H, et al.
    Molecular genetics of blood-fleshed peach reveals activation of anthocyanin biosynthesis by NAC transcription factors.
    Plant J., 2015. 82(1): p. 105-21
    [PMID:25688923]