PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.6G365600.4.p
Common NamePRUPE_ppa027059mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family LBD
Protein Properties Length: 247aa    MW: 26869.1 Da    PI: 8.1895
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.6G365600.4.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260145.51.5e-45121111100
              DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91 
                         +CaaCk+lrrkC+++Cv+apyfp +qp+kfanvhk+FGasnv+kll++l++++reda++sl+yeA++r+rdPvyG+vgvi+ lq+ql+ql+
  Prupe.6G365600.4.p  12 PCAACKFLRRKCQPECVFAPYFPPDQPQKFANVHKVFGASNVTKLLNELHPHQREDAVNSLAYEADMRLRDPVYGCVGVISLLQHQLRQLQ 102
                         7****************************************************************************************** PP

              DUF260  92 aelallkee 100
                          +l  +k+e
  Prupe.6G365600.4.p 103 MDLTCAKSE 111
                         ***999876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.17211112IPR004883Lateral organ boundaries, LOB
PfamPF031959.5E-4512109IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009799Biological Processspecification of symmetry
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0009954Biological Processproximal/distal pattern formation
GO:0048441Biological Processpetal development
GO:0005654Cellular Componentnucleoplasm
Sequence ? help Back to Top
Protein Sequence    Length: 247 aa     Download sequence    Send to blast
MMASSSSSSN SPCAACKFLR RKCQPECVFA PYFPPDQPQK FANVHKVFGA SNVTKLLNEL  60
HPHQREDAVN SLAYEADMRL RDPVYGCVGV ISLLQHQLRQ LQMDLTCAKS ELSKYQNLQH  120
GLTASHGLIA AAAAAAAAHT HHPLHLQSSS STLHNNNNNL GMGINLISGG GGGRDHYPHQ  180
FFPRDRDHQH QQQMMIRSFD AGNNYDASLL AMNVSAAAGG IHGQLTHQFQ QPRAAAGDDR  240
RTIDPS*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00211DAPTransfer from AT1G65620Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9215740.0EU921574.1 Prunus mume clone GB-PrM-112 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007206843.10.0hypothetical protein PRUPE_ppa027059mg
SwissprotO044792e-85LBD6_ARATH; LOB domain-containing protein 6
TrEMBLM5W2T30.0M5W2T3_PRUPE; Uncharacterized protein
STRINGVIT_00s0340g00090.t011e-111(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65620.41e-78LBD family protein