PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.6G364300.1.p
Common NamePRUPE_ppb008343mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family FAR1
Protein Properties Length: 267aa    MW: 30000 Da    PI: 6.0541
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.6G364300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR189.26e-2884171290
                FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHela 90 
                         fYn+Y+ +vGF +r+++  +sk+ g+i+ rtfvC+keg+r++++++ +++ ++ra tr+gCka+l +kk + gkw+vt++ +eH+H+l+
  Prupe.6G364300.1.p  84 FYNAYGMRVGFMTRMNYLARSKHGGTIIGRTFVCNKEGYRKPDRRD-KTTIKPRAPTRVGCKAMLSIKKISIGKWVVTRFMKEHTHALT 171
                         *******************************************999.999************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031017.8E-2584171IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 267 aa     Download sequence    Send to blast
MDSELDININ DGVLNDSSDA ELKHSNDGAL VGSFVEVEEM SHLGQGQDDE VTQNPCKDGS  60
SVVVEAHEPY VGQEFDTEET AQAFYNAYGM RVGFMTRMNY LARSKHGGTI IGRTFVCNKE  120
GYRKPDRRDK TTIKPRAPTR VGCKAMLSIK KISIGKWVVT RFMKEHTHAL TATANKGQKG  180
LIADQVPDDK TKIEELTREL FLERKQSASL REIVDLLFDH IEEHTQDLSK KVQYVVDKVK  240
EIESEGKSPS ILNLMYTVYI HISFII*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.6G364300.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007206868.10.0protein FAR1-RELATED SEQUENCE 12 isoform X4
TrEMBLM5W2V70.0M5W2V7_PRUPE; Uncharacterized protein
STRINGEMJ080670.0(Prunus persica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF24533072
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G59470.22e-64FAR1 family protein