PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.6G351000.1.p
Common NamePRUPE_ppa005708mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family G2-like
Protein Properties Length: 459aa    MW: 51415.8 Da    PI: 4.9647
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.6G351000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like103.71.1e-32231285155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         kpr+rWt+eLHe+Fveav+qL Gse+AtPk il+lmkv+gLt++hvkSHLQkYR+
  Prupe.6G351000.1.p 231 KPRMRWTQELHEAFVEAVNQLDGSERATPKGILNLMKVEGLTIYHVKSHLQKYRT 285
                         79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.055228288IPR017930Myb domain
SuperFamilySSF466891.04E-17229285IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.4E-30230287IPR009057Homeodomain-like
TIGRFAMsTIGR015578.6E-25231285IPR006447Myb domain, plants
PfamPF002492.3E-8233284IPR001005SANT/Myb domain
PfamPF143791.4E-19316363IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 459 aa     Download sequence    Send to blast
MSNFGSSKAM SSSFPNLSTP LDDKYSRLPD SFQVTSQREK TRYSKLPQDS SPGHLFSSSS  60
RPNDVHFSSV SPCESRSQNS PFIFKLPVDE KSLSLTHSSH SEVQPTALIN YSEENKDISW  120
YPDSLQEFLH FPENVPDQTG LVDSSTGVIT SEDHAEKTDW SDWDPLISFD DALDPNWELP  180
IDVDAVDPKP KVLNPYSDIL VQPPQIQQHQ PVQSEEFRPS PETLSTAPPT KPRMRWTQEL  240
HEAFVEAVNQ LDGSERATPK GILNLMKVEG LTIYHVKSHL QKYRTARYKP ESSEGACEKV  300
STPVEETNSL DLKASMGITE ALRLQVELQK RLHEQLENQR KLQLQIEEQG KYLEKMFEQQ  360
RKMEDSRVKA ASSTVDDHAT PPSNLVCPSP GEDKPETSKH DHGKTPISAS SMSTPLEEGS  420
QDANRKKQKA QETVSQEEPD HPGDVESGTQ PTKRARNG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A7e-29231289260Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B7e-29231289260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A7e-29231289260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C7e-29231289260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D7e-29231289260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F7e-29231289260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H7e-29231289260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J7e-29231289260Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppe.37920.0fruit
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.6G351000.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020421921.10.0protein PHR1-LIKE 1 isoform X1
TrEMBLA0A251P0B90.0A0A251P0B9_PRUPE; Uncharacterized protein
STRINGEMJ063960.0(Prunus persica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15123498
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G29000.25e-89G2-like family protein