PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.6G286000.1.p
Common NamePRUPE_ppa004009mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family WRKY
Protein Properties Length: 536aa    MW: 59336 Da    PI: 7.3047
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.6G286000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY102.32.7e-32234291260
                         --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
                WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                         dDg+nWrKYGqK+vkgse+prsYY+Ct+++C++kkkvers  d+++++i+Y+g+Hnh+k
  Prupe.6G286000.1.p 234 DDGFNWRKYGQKQVKGSENPRSYYKCTYPNCSTKKKVERSL-DGHITQIVYKGSHNHPK 291
                         8****************************************.***************85 PP

2WRKY105.92.1e-33398456159
                         ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                         ldDgy+WrKYGqK+vkg+++prsYY+Cts gCpv+k+ver+++d+++v++tYeg+Hnh+
  Prupe.6G286000.1.p 398 LDDGYRWRKYGQKVVKGNPNPRSYYKCTSVGCPVRKHVERASHDTRAVITTYEGKHNHD 456
                         59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.803.4E-27226292IPR003657WRKY domain
PROSITE profilePS5081123.032228292IPR003657WRKY domain
SuperFamilySSF1182909.81E-25230292IPR003657WRKY domain
SMARTSM007741.1E-34233291IPR003657WRKY domain
PfamPF031061.8E-24234290IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.9E-37383458IPR003657WRKY domain
SuperFamilySSF1182901.96E-29390458IPR003657WRKY domain
PROSITE profilePS5081138.779393458IPR003657WRKY domain
SMARTSM007743.1E-39398457IPR003657WRKY domain
PfamPF031061.3E-25399456IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009651Biological Processresponse to salt stress
GO:0070370Biological Processcellular heat acclimation
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 536 aa     Download sequence    Send to blast
MTSSFTHLLT SNMNNMDSNI DQERTNWGLS DYSSGSLMDR NGNEIPNFKS LQPPSLPMSP  60
PPVSPSSYLA STPAFSPTDF FSSPMFLSSS NTLQSPTSGA FSSQIFDWMS NSKETQQGME  120
REQKMFSDFS FQPETRPAAT SSSTFNIQAS SNMASEESLK TGQKPWDFNR ISRQADSLTE  180
KTGVKSEFEP LQSIFPEIGT NQTNMQSNGP SGAPKPDTIH CTQSSQFVRE QKSDDGFNWR  240
KYGQKQVKGS ENPRSYYKCT YPNCSTKKKV ERSLDGHITQ IVYKGSHNHP KPQSTRRSTS  300
QSIQGSSYGI SDQSVPTISN PKIESVTMQE DSSASIGEDE FEQNSPISNS GGAEDENEPE  360
AKRWKGENAN DQPFSAPGSR IVKEPRIVVQ TTSEIDILDD GYRWRKYGQK VVKGNPNPRS  420
YYKCTSVGCP VRKHVERASH DTRAVITTYE GKHNHDVPAA RGSGSYSNAN RPASDNGSNN  480
NSNVSMAVRP LALPNHSNLS YLNSLQNTRQ PTTERQSPYT LKMLQSEGSY GFPEF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A8e-34234459878Probable WRKY transcription factor 4
2lex_A8e-34234459878Probable WRKY transcription factor 4
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: In dry seeds, expressed in aleurone cells and embryos. Levels drop rapidly but transiently in the embryos of imbibed seeds. {ECO:0000250|UniProtKB:Q6IEQ7}.
UniprotTISSUE SPECIFICITY: Expressed in aleurone cells. Mostly expressed in aleurone layers and leaves, and, to a lower extent, in roots, panicles and embryos. {ECO:0000250|UniProtKB:Q6IEQ7}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription repressor (By similarity). Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element. Negative regulator of both gibberellic acid (GA) and abscisic acid (ABA) signaling in aleurone cells, probably by interfering with GAM1, via the specific repression of GA- and ABA-induced promoters (By similarity). {ECO:0000250|UniProtKB:Q6IEQ7, ECO:0000250|UniProtKB:Q6QHD1}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.6G286000.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by abscisic acid (ABA) in aleurone cells, embryos, roots and leaves (PubMed:25110688). Slightly down-regulated by gibberellic acid (GA) (By similarity). Accumulates in response to jasmonic acid (MeJA) (PubMed:16919842). {ECO:0000250|UniProtKB:Q6IEQ7, ECO:0000269|PubMed:16919842, ECO:0000269|PubMed:25110688}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007205027.10.0probable WRKY transcription factor 33
SwissprotQ6B6R41e-119WRK24_ORYSI; WRKY transcription factor WRKY24
TrEMBLM5VYP10.0M5VYP1_PRUPE; Uncharacterized protein
STRINGEMJ062260.0(Prunus persica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF107734114
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38470.11e-109WRKY DNA-binding protein 33
Publications ? help Back to Top
  1. Basu S,Roychoudhury A
    Expression profiling of abiotic stress-inducible genes in response to multiple stresses in rice (Oryza sativa L.) varieties with contrasting level of stress tolerance.
    Biomed Res Int, 2014. 2014: p. 706890
    [PMID:25110688]