PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.6G282300.1.p
Common NamePRUPE_ppa021179mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family G2-like
Protein Properties Length: 340aa    MW: 38236.2 Da    PI: 7.3926
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.6G282300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.55.3e-3267120255
             G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         prlrWtp+LH rF++ave+LGG+e+AtPk +l+lm++kgL+++hvkSHLQ+YR+
  Prupe.6G282300.1.p  67 PRLRWTPDLHLRFIHAVERLGGQERATPKLVLQLMNIKGLSIAHVKSHLQMYRS 120
                         8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.9E-3063121IPR009057Homeodomain-like
PROSITE profilePS5129412.68563123IPR017930Myb domain
SuperFamilySSF466891.47E-1465121IPR009057Homeodomain-like
TIGRFAMsTIGR015579.3E-2367122IPR006447Myb domain, plants
PfamPF002499.8E-1068119IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 340 aa     Download sequence    Send to blast
MEGDSDSSKT SPSGEQTEGG SESGENYDDI EESGKPKNNG GSSSNSTVEE SDQRKASVRP  60
YVRSKMPRLR WTPDLHLRFI HAVERLGGQE RATPKLVLQL MNIKGLSIAH VKSHLQMYRS  120
KKIDDAGQVL ADHQGHLVEC GDKNIYNLSQ LPMLQGYNRS HSTSFRYGDA KSWTAYENPR  180
YPRSSGFQGN WSSSSAYNYL TSCSFGEQSS WIARTLKQEC QLYNIRESLQ AQHQHQARLS  240
QQLIDLNPTN THVQVQPKPK ELITSFNNSN NLELTSKKNE DHQSKSLKRT ASDCEDLDLD  300
LSLRLTSRNK NEDDIHEVDS SLSLSLYSPP TSKLSRLKE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-1768122458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-1768122458Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A2e-1768122357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-1768122357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-1768122357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-1768122357Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-1768122458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-1768122458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-1768122458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-1768122458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-1768122458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-1768122458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00297DAPTransfer from AT2G38300Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.6G282300.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020422160.10.0transcription repressor KAN1
TrEMBLA0A251NWW30.0A0A251NWW3_PRUPE; Uncharacterized protein
STRINGXP_008243158.10.0(Prunus mume)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23783482
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.17e-62G2-like family protein