PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.6G282200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family bZIP
Protein Properties Length: 171aa    MW: 18913 Da    PI: 10.372
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.6G282200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_120.11.4e-065497548
                        CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1  5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkke 48
                        k  rr   NReAArr   RKk++  +Le+++ke e+   +L+++
  Prupe.6G282200.1.p 54 KQLRRILANREAARRAHSRKKEYERKLEREAKEAEERVAMLASK 97
                        67788899*************************99999999887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.3E-550114IPR004827Basic-leucine zipper domain
PROSITE profilePS502178.84152115IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1706.2E-552108No hitNo description
SuperFamilySSF579591.13E-654108No hitNo description
PfamPF031314.4E-554115IPR004826Basic leucine zipper domain, Maf-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 171 aa     Download sequence    Send to blast
MEQQQAKTSA GNHSQSAASG STSSPENKSS QMETIQSPNP IPSSTGDAGP SDPKQLRRIL  60
ANREAARRAH SRKKEYERKL EREAKEAEER VAMLASKVAF QRMHLTILSG KNSQMRETLQ  120
VLENHQAHKE AETEALVKER ETLLLLRSLQ LQQQQGGSSR SSNNPNNVDK *
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.6G282200.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020422756.11e-119basic leucine zipper 6-like
TrEMBLA0A251NWW11e-118A0A251NWW1_PRUPE; Uncharacterized protein
STRINGXP_008370276.12e-38(Malus domestica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G58120.18e-08bZIP family protein